KEGG   Moritella sp. 36: HWV03_21860
Entry
HWV03_21860       CDS       T08847                                 
Name
(GenBank) hypothetical protein
Organism
moq  Moritella sp. 36
SSDB
Other DBs
NCBI-ProteinID: QUM91219
LinkDB
Position
complement(4904689..4904913)
AA seq 74 aa
MIPGMGGLTGGISGGAGGMPISAGGGASGDSTATSTSHFGGIKQGAINMGGGGITAQLPM
IAVVCVLLFVMVKK
NT seq 225 nt   +upstreamnt  +downstreamnt
atgattccgggcatgggtggattaacaggcggtatttctggcggcgctggcggtatgccg
attagtgcgggtggtggtgcttcgggtgattcaaccgctacatcaaccagtcattttggc
ggaattaaacagggtgcaattaatatgggtggcggtggcattacggcgcagttacccatg
attgcggtggtttgcgtgttgttatttgtgatggtgaaaaaatga

DBGET integrated database retrieval system