Methylobacterium oryzae: MOC_0893 Help Entry MOC_0893          CDS       T03299                                  Symbol atpE Name (GenBank) ATP synthase F0, C subunit   KO K02110   F-type H+-transporting ATPase subunit c Organism mor  Methylobacterium oryzae Pathway mor00190   Oxidative phosphorylation mor01100   Metabolic pathways Module mor_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:mor00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     MOC_0893 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mor00194]     MOC_0893 (atpE) Photosynthesis proteins [BR:mor00194]  Photosystem and electron transport system   F-type ATPase [OT]    MOC_0893 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AIQ88648 UniProt:  A0A089NS20 LinkDB All DBs Position complement(882013..882240) Genome browser AA seq 75 aa AA seqDB search MDPVAAKYIGAGLACLGMAGAGIGLGNLFGQFLAGALRNPSAADGQRATLLLGFALTEAL GIFSLLIALLLLFAV NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggatcccgtcgctgcgaagtacatcggcgccggcctcgcttgcctcggcatggcgggt gcgggcatcggcctcggcaacctgttcggtcagttcctcgccggcgcccttcgcaacccg tctgcggccgacggccagcgcgccaccctgctcctgggcttcgccctcaccgaggcgctc ggcatcttctcgctgctgatcgccctgctgctgctcttcgccgtctga

DBGET integrated database retrieval system