Methylobacterium oryzae: MOC_5526
Help
Entry
MOC_5526 CDS
T03299
Name
(GenBank) Chemotaxis response regulator protein-glutamate methylesterase CheB
KO
K03412
two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:
3.1.1.61
3.5.1.44
]
Organism
mor
Methylobacterium oryzae
Pathway
mor02020
Two-component system
mor02030
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:
mor00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
MOC_5526
09140 Cellular Processes
09142 Cell motility
02030 Bacterial chemotaxis
MOC_5526
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
mor02022
]
MOC_5526
02035 Bacterial motility proteins [BR:
mor02035
]
MOC_5526
Enzymes [BR:
mor01000
]
3. Hydrolases
3.1 Acting on ester bonds
3.1.1 Carboxylic-ester hydrolases
3.1.1.61 protein-glutamate methylesterase
MOC_5526
3.5 Acting on carbon-nitrogen bonds, other than peptide bonds
3.5.1 In linear amides
3.5.1.44 protein-glutamine glutaminase
MOC_5526
Two-component system [BR:
mor02022
]
CheA family
CheA-CheYBV (chemotaxis)
MOC_5526
Bacterial motility proteins [BR:
mor02035
]
Flagellar system
Chemotaxis proteins
Two component system proteins
MOC_5526
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CheB_methylest
CheR
Response_reg
CheR_N
Methyltransf_25
Methyltransf_12
Methyltransf_11
Methyltransf_23
Motif
Other DBs
NCBI-ProteinID:
AIQ93281
UniProt:
A0A089NZ86
LinkDB
All DBs
Position
5548721..5550592
Genome browser
AA seq
623 aa
AA seq
DB search
MPAFQLPPAKRTMVEGRLRKRMRALDLPTLEAYGHHLFEAGHLADEFPHLVDCVTTNKTD
FFREPAHFDLLRTTIVPRLAARGDRPLLKVWSAAASTGAEAYTLAMVLQDMAADRFRYAI
LGTDISSEVLDRARTAIYPEEMLEAVPPDLRRRYVMVARDPARREGRIVPELRARVRFQR
LNLMDESYPIDRDVDLVFCRNVLIYFDKPTQKAVVARLAGHLRPGGYLIVGHSESMAGVG
VAGLDQIVLDRLQQAEGFRPVNASRPIRVLIVDDSASVRQTLCGILETAPDIAVLGTAAD
PFIAARRIQEEIPDVIILDLEMPRMDGLTFLRKIMAQKPLPVIVCSTLTEAGSRILFEVL
EAGAVDVLPKPRVDTRQFLLESTVRVCDAVRAAARAKLRGSRPPRQLVEAKLSADVVLPP
PVPGRVVVETDRIVCIGASTGGTEALRDVLEVLPAESPGLVIVQHMPEHFTAAFAKRLNG
LCAITVKEAEDGDPVLRGRALIAPGGRHLMVERRGGSYAVSVKDGPLVARHRPSVDVLFR
SAARAAAANALGILMTGMGDDGANGLLEMRRAGAQTVAQDEASCVVFGMPKEAIDRGAAA
KVLPLEQMPGEIRRFGLTVAGPR
NT seq
1872 nt
NT seq
+upstream
nt +downstream
nt
atgccggcattccagctgccgccggccaagcgcaccatggtcgagggccggctgcgcaag
cgcatgcgcgccctcgatcttccgaccctcgaggcctatggccaccacctgttcgaggcg
ggccatctcgcggacgagttcccgcacctcgtcgactgcgtgacgacgaacaagaccgac
ttcttccgcgagccggcgcatttcgatctgctgcgcacgacgatcgtcccgcggctggcg
gcgcggggcgaccggccgctgctcaaggtctggagcgcggcggcttcgaccggggcggag
gcctatacgctggcgatggtcctgcaggacatggccgccgaccggttccgctacgccatc
ctcgggaccgacatctcctcggaggtgctcgaccgcgcccggacggcgatctacccggag
gagatgctggaggcggtgccgccggacctgcggcggcgctacgtgatggtcgcgcgcgat
ccggcccgccgcgaggggcggatcgtgcccgagctgcgcgcccgggtgcggttccagcgg
ctcaacctgatggacgaaagctacccgatcgaccgggacgtcgacctcgtcttctgccgc
aacgtgctgatctacttcgacaagccgacccagaaggccgtggtcgcacgcctggccggg
cacctgcgccccggcggatacctgatcgtcggccattccgaatcgatggcgggcgtcggc
gtggcgggcctcgaccagattgtcctcgaccgtcttcagcaagctgagggattccggccg
gtgaatgcgtcgagaccgatccgcgtcctcatcgtcgacgactcggcctccgtccgccag
accctgtgcggcatcctggagacggcgcccgacatcgcggtcctgggtaccgcggccgat
ccgttcatcgccgcccgccggatccaggaggagatcccggacgtcatcatcctcgatctc
gagatgccgcgcatggacggcctgaccttcctgcgcaagatcatggcgcagaagccgctc
ccggtgatcgtctgctcgaccctgaccgaggcgggttcccggatcctgttcgaggtgctg
gaggcgggcgccgtcgacgtactgccgaagccgcgggtcgacacccgccagttcctgctc
gaatccacggtgcgggtctgcgacgcggtgcgcgcggccgcccgggccaagctgcgcggc
agccggccgccgcgacagctcgtcgaagcgaagctctcggccgatgttgtcctgccgccg
cccgtgcccggacgcgtcgtggtcgagaccgaccggatcgtctgcatcggcgcgtcgacg
ggcgggacggaagccctgcgcgacgtgctcgaggtgctgcccgccgagtcccccggcctc
gtcatcgtgcagcacatgccggagcacttcacggcggccttcgccaagcgcctgaacggg
ctctgcgcgatcaccgtcaaggaggcggaggacggcgatccggtgctgcggggccgggcc
ctgatcgccccgggcgggcggcacctcatggtcgagcgccgaggcggcagctacgcggtg
tcggtgaaggacggtccgctcgtcgcgcgccatcgcccgtccgtcgatgtgctgttccgg
tcggccgcccgggcggcggccgcgaacgcgctgggcatcctgatgaccggcatgggcgac
gacggcgccaacggcctgctggagatgcgccgggccggggcgcagaccgtggcgcaggac
gaggcgagttgcgtggtgttcgggatgcccaaggaggcgatcgaccgcggcgcggccgcc
aaggtcctgccgctcgagcagatgcccggggagatccggcggttcggcctgaccgtggcg
gggccgcgctga
DBGET
integrated database retrieval system