Marasmius oreades (fairy-ring mushroom): 66069960 Help Entry 66069960          CDS       T08156                                  Name (RefSeq) uncharacterized protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism more  Marasmius oreades (fairy-ring mushroom) Pathway more03020   RNA polymerase more03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:more00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     66069960   09124 Replication and repair    03420 Nucleotide excision repair     66069960  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:more03021]     66069960    03400 DNA repair and recombination proteins [BR:more03400]     66069960 Transcription machinery [BR:more03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      66069960   RNA polymerase III system    RNA polymerase III      66069960   RNA polymerase I system    RNA polymerase I      66069960 DNA repair and recombination proteins [BR:more03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       66069960 SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 MT Motif Other DBs NCBI-GeneID:  66069960 NCBI-ProteinID:  XP_043015468 UniProt:  A0A9P8AEY8 LinkDB All DBs Position 1:2797767..2798936 Genome browser AA seq 168 aa AA seqDB search MSDDGYGGGGGAADDYDYDGPSYAEDAFVDDSYDLLANQDVEGQQGEEGADQGPHINGIN GADHDQEMANGEDGQQPPVTTSALGERQPNKERVTTPYLTKYERARILGTRALQISMNAP VLVPLDGETDALQIAIKELSQRKIPLIIRRYLPDGSFEDWSVSELITD NT seq 507 nt NT seq  +upstreamnt  +downstreamnt atgtctgatgatggttatggtggaggtggaggtgcagcagacgattatgactacgacggc cctagttacgccgaagatgctttcgttgacgacagctatgatctacttgcaaatcaggac gttgaaggtcaacaaggcgaagagggcgccgatcaagggcctcatataaatggaatcaac ggggcagatcatgaccaagagatggcgaacggtgaagacggtcaacaaccacctgtcact acaagtgcacttggggaaaggcagcccaacaaagaacgcgtaacgacaccatacctaaca aaatacgagcgtgcacggattttagggacgagagcgctgcagatcagcatgaacgctcca gttctcgttcccttggatggtgaaacggacgctcttcaaattgccatcaaagaattgtcc caacgaaaaatccccctcatcattcgacggtaccttccagatggtagtttcgaagattgg agtgtgtcggaattgatcaccgactga

DBGET integrated database retrieval system