Marasmius oreades (fairy-ring mushroom): 66071491 Help Entry 66071491          CDS       T08156                                  Symbol CDC42 Name (RefSeq) Rho GTPase   KO K04393   cell division control protein 42 Organism more  Marasmius oreades (fairy-ring mushroom) Pathway more04011   MAPK signaling pathway - yeast more04144   Endocytosis more04517   IgSF CAM signaling more04518   Integrin signaling more04519   Cadherin signaling more05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:more00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     66071491 (CDC42)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     66071491 (CDC42)    04518 Integrin signaling     66071491 (CDC42)    04519 Cadherin signaling     66071491 (CDC42)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     66071491 (CDC42)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     66071491 (CDC42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:more04131]     66071491 (CDC42)    03036 Chromosome and associated proteins [BR:more03036]     66071491 (CDC42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:more04147]     66071491 (CDC42)    04031 GTP-binding proteins [BR:more04031]     66071491 (CDC42) Membrane trafficking [BR:more04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     66071491 (CDC42)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     66071491 (CDC42)   Macropinocytosis    Ras GTPases     66071491 (CDC42) Chromosome and associated proteins [BR:more03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     66071491 (CDC42) Exosome [BR:more04147]  Exosomal proteins   Exosomal proteins of microglial cells    66071491 (CDC42)   Exosomal proteins of breast milk    66071491 (CDC42) GTP-binding proteins [BR:more04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     66071491 (CDC42) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  66071491 NCBI-ProteinID:  XP_043002934 UniProt:  A0A9P7ULD1 LinkDB All DBs Position 10:complement(1109946..1111536) Genome browser AA seq 193 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGEDPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVKEKWFPEVHHHCPGVPCLIVGTQIDLR DDAQVIEKLARQKQRPVTNEQGERLARELGAVKYVECSALTQKGLKNVFDEAIVAALEPP VVKKGKKLGCLIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgcagactatcaagtgtgtagtagttggcgacggtgctgtgggtaagacctgtttgttg atatcgtataccaccaacaagttccccagtgaatatgtgccaaccgtttttgataattac gctgtcacggtcatgattggggaggacccctatacattaggtctgtttgataccgccggt caggaagattacgatcgtcttcgtccgttatcgtacccacagacggacgttttccttgtc tgttttagcgtaacatctcccgcatcgttcgagaacgtgaaggaaaaatggttcccagag gtgcatcaccactgtcctggtgtcccatgcctgatcgttgggactcaaattgatttgcgg gacgacgctcaagttatagaaaagttggcgcgacagaaacaacgaccggtaacgaacgag caaggtgaaagacttgcacgggagctaggagcagtgaaatatgtcgaatgttcggcgttg acgcaaaaggggttgaaaaacgtgtttgatgaggctatcgttgctgcccttgaaccaccc gtcgttaagaagggcaagaaactgggctgtctcattctgtga

DBGET integrated database retrieval system