Marasmius oreades (fairy-ring mushroom): 66075099 Help Entry 66075099          CDS       T08156                                  Name (RefSeq) uncharacterized protein   KO K09481   protein transport protein SEC61 subunit beta Organism more  Marasmius oreades (fairy-ring mushroom) Pathway more03060   Protein export more04141   Protein processing in endoplasmic reticulum more04145   Phagocytosis more04149   Peroxisome - yeast Brite KEGG Orthology (KO) [BR:more00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     66075099    04141 Protein processing in endoplasmic reticulum     66075099  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     66075099    04149 Peroxisome - yeast     66075099  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:more04131]     66075099   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:more02044]     66075099 Membrane trafficking [BR:more04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     66075099 Secretion system [BR:more02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    66075099 SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta SosA Motif Other DBs NCBI-GeneID:  66075099 NCBI-ProteinID:  XP_043011720 UniProt:  A0A9P7S4R1 LinkDB All DBs Position 3:2216344..2217049 Genome browser AA seq 98 aa AA seqDB search MSDSDSPRGSPRPNSSSGVAKPPGAQVRRRATGSQVTKPNSTRAAGAGGSSNTMLKLYTD DSPGLRVDPFIVIVLSVCFIGSIFFLHISAKIIRSFSK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctgactcggactcacctcgaggtagccctcggcccaattcatcgagcggcgtagct aaaccacctggtgcgcaagttcgacgacgtgctacaggctcgcaggtaaccaaaccaaat tcaacacgggcagcgggtgccggagggtcatcgaatacgatgctcaaactttacaccgat gattcaccgggcctccgagtagatccatttattgtcatcgttctttccgtttgcttcatt ggttccatttttttcctccacatttccgccaagattattcgttccttctccaagtaa

DBGET integrated database retrieval system