Marasmius oreades (fairy-ring mushroom): 66076297 Help Entry 66076297          CDS       T08156                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism more  Marasmius oreades (fairy-ring mushroom) Pathway more04145   Phagocytosis more04517   IgSF CAM signaling more04814   Motor proteins Brite KEGG Orthology (KO) [BR:more00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     66076297  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     66076297   09142 Cell motility    04814 Motor proteins     66076297  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:more03037]     66076297    04812 Cytoskeleton proteins [BR:more04812]     66076297 Cilium and associated proteins [BR:more03037]  Motile cilia and associated proteins   Dynein arm    66076297 Cytoskeleton proteins [BR:more04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      66076297 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light RNase_R_N Motif Other DBs NCBI-GeneID:  66076297 NCBI-ProteinID:  XP_043010021 UniProt:  A0A9P7S184 LinkDB All DBs Position 4:<1295662..>1296097 Genome browser AA seq 113 aa AA seqDB search MAEKLDAPTSSSTDTSTGPRGATDGAVAPKAIIKNVDMSEEMQQESVDIASAALEKYNIE KDIAAQIKKEFDRRHGPTWHVVVGKNFGSYVTHETKHFIYFYVGSLAILIWKS NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggccgaaaaactcgacgcgccaacttcttcatccaccgacaccagcacgggcccacga ggtgctaccgacggggctgttgcacccaaggcgataataaagaatgtcgacatgagcgaa gaaatgcagcaggaaagcgtcgatattgcttcagcagcgctggaaaaatacaacatagag aaggacattgccgcacagatcaagaaggagtttgaccgaaggcacggtcctacatggcac gtagtcgtcggaaagaattttgggagctatgttacacatgaaacgaagcatttcatttac ttttacgtcggatccctcgcaattctcatctggaagtcatag

DBGET integrated database retrieval system