Marasmius oreades (fairy-ring mushroom): 66078732 Help Entry 66078732          CDS       T08156                                  Name (RefSeq) uncharacterized protein   KO K03358   anaphase-promoting complex subunit 11 Organism more  Marasmius oreades (fairy-ring mushroom) Pathway more04111   Cell cycle - yeast more04113   Meiosis - yeast more04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:more00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     66078732  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     66078732    04113 Meiosis - yeast     66078732  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:more04121]     66078732    03036 Chromosome and associated proteins [BR:more03036]     66078732 Ubiquitin system [BR:more04121]  Ubiquitin ligases (E3)   Multi subunit type E3    APC/C     Ring finger protein      66078732 Chromosome and associated proteins [BR:more03036]  Eukaryotic type   Sister chromatid separation proteins    APC/C complex     66078732 SSDB OrthologParalogGFIT Motif Pfam:  zf-ANAPC11 zf-rbx1 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX zf_RING_Vps8_fungal zf-C3HC4 Motif Other DBs NCBI-GeneID:  66078732 NCBI-ProteinID:  XP_043007017 UniProt:  A0A9P7RW76 LinkDB All DBs Position 6:762421..763261 Genome browser AA seq 103 aa AA seqDB search MRVTVKRWHAVAQWRWDTGNDDADGDEGDVCGICRVPYEGCCPSCKVPGDDCPLIWGECS HVFHMHCLLKWIGTAASKQQCPMDRRAWVTAERKVAKPMISSS NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgcgggttactgtcaaacgttggcatgcagtggcacaatggcgttgggacaccgggaat gacgatgcagacggtgatgagggcgacgtttgtggaatatgtcgagtgccatatgaagga tgttgtccgtcgtgtaaggttccaggagacgattgtcctctaatttggggcgaatgcagc catgtattccatatgcactgtcttctgaagtggattggaactgcagcttctaagcagcaa tgtcccatggatcgaagagcatgggtcactgctgaacgaaaagtggcaaagcccatgata tcgtcttcatga

DBGET integrated database retrieval system