Marasmius oreades (fairy-ring mushroom): E1B28_002415 Help Entry E1B28_002415      CDS       T08156                                  Symbol CDC42 Name (RefSeq) Rho GTPase   KO K04393   cell division control protein 42 Organism more  Marasmius oreades (fairy-ring mushroom) Pathway more04011   MAPK signaling pathway - yeast more04144   Endocytosis more04517   IgSF CAM signaling more04518   Integrin signaling more05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:more00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     E1B28_002415 (CDC42)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     E1B28_002415 (CDC42)    04518 Integrin signaling     E1B28_002415 (CDC42)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     E1B28_002415 (CDC42)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     E1B28_002415 (CDC42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:more04131]     E1B28_002415 (CDC42)    03036 Chromosome and associated proteins [BR:more03036]     E1B28_002415 (CDC42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:more04147]     E1B28_002415 (CDC42)    04031 GTP-binding proteins [BR:more04031]     E1B28_002415 (CDC42) Membrane trafficking [BR:more04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     E1B28_002415 (CDC42)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     E1B28_002415 (CDC42)   Macropinocytosis    Ras GTPases     E1B28_002415 (CDC42) Chromosome and associated proteins [BR:more03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     E1B28_002415 (CDC42) Exosome [BR:more04147]  Exosomal proteins   Exosomal proteins of microglial cells    E1B28_002415 (CDC42)   Exosomal proteins of breast milk    E1B28_002415 (CDC42) GTP-binding proteins [BR:more04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     E1B28_002415 (CDC42) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  66071491 NCBI-ProteinID:  XP_043002934 UniProt:  A0A9P7ULD1 LinkDB All DBs Position 10:complement(1109946..1111536) Genome browser AA seq 193 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGEDPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVKEKWFPEVHHHCPGVPCLIVGTQIDLR DDAQVIEKLARQKQRPVTNEQGERLARELGAVKYVECSALTQKGLKNVFDEAIVAALEPP VVKKGKKLGCLIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgcagactatcaagtgtgtagtagttggcgacggtgctgtgggtaagacctgtttgttg atatcgtataccaccaacaagttccccagtgaatatgtgccaaccgtttttgataattac gctgtcacggtcatgattggggaggacccctatacattaggtctgtttgataccgccggt caggaagattacgatcgtcttcgtccgttatcgtacccacagacggacgttttccttgtc tgttttagcgtaacatctcccgcatcgttcgagaacgtgaaggaaaaatggttcccagag gtgcatcaccactgtcctggtgtcccatgcctgatcgttgggactcaaattgatttgcgg gacgacgctcaagttatagaaaagttggcgcgacagaaacaacgaccggtaacgaacgag caaggtgaaagacttgcacgggagctaggagcagtgaaatatgtcgaatgttcggcgttg acgcaaaaggggttgaaaaacgtgtttgatgaggctatcgttgctgcccttgaaccaccc gtcgttaagaagggcaagaaactgggctgtctcattctgtga

DBGET integrated database retrieval system