Marasmius oreades (fairy-ring mushroom): E1B28_005563 Help Entry E1B28_005563      CDS       T08156                                  Name (RefSeq) uncharacterized protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism more  Marasmius oreades (fairy-ring mushroom) Pathway more03020   RNA polymerase more03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:more00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     E1B28_005563   09124 Replication and repair    03420 Nucleotide excision repair     E1B28_005563  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:more03021]     E1B28_005563    03400 DNA repair and recombination proteins [BR:more03400]     E1B28_005563 Transcription machinery [BR:more03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      E1B28_005563   RNA polymerase III system    RNA polymerase III      E1B28_005563   RNA polymerase I system    RNA polymerase I      E1B28_005563 DNA repair and recombination proteins [BR:more03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       E1B28_005563 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_N Motif Other DBs NCBI-GeneID:  66074639 NCBI-ProteinID:  XP_043011216 UniProt:  A0A9P7S4U2 LinkDB All DBs Position 3:complement(796782..797518) Genome browser AA seq 129 aa AA seqDB search MHIIEFALRARTEDVMSTVYQSRAQQIPVAIRGLGIFAPAPCPGLSSTFNYYSSCTSMII PVRCFSCGKVVGDKWNAYLDLLGKDVSEGDALDELQLKRYCCRRMVLTHVDLIEKLLHYN PMERSKEKV NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgcacattattgaatttgcgctgcgagcgcgaaccgaagacgtcatgtctactgtatac caatcacgtgcccaacagatacccgtcgccatccgtggccttggcattttcgctccagct ccttgtcctggactgtcctcaactttcaattattatagttcgtgcacgagcatgatcatt ccagttcggtgtttctcttgcggaaaagtggtcggggacaaatggaacgcatatctggac ctgttaggaaaggatgttagtgaaggtgatgctcttgatgaactccagttgaaaagatat tgctgtcggcgtatggtattaactcatgtggatttgattgaaaaactcctgcattacaat ccaatggagaggtccaaggagaaggtctag

DBGET integrated database retrieval system