Marasmius oreades (fairy-ring mushroom): E1B28_005564 Help Entry E1B28_005564      CDS       T08156                                  Name (RefSeq) uncharacterized protein   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism more  Marasmius oreades (fairy-ring mushroom) Pathway more03018   RNA degradation more03040   Spliceosome Brite KEGG Orthology (KO) [BR:more00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     E1B28_005564   09123 Folding, sorting and degradation    03018 RNA degradation     E1B28_005564  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:more03019]     E1B28_005564    03041 Spliceosome [BR:more03041]     E1B28_005564 Messenger RNA biogenesis [BR:more03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      E1B28_005564   mRNA degradation factors    5'-3' decay     Lsm complex      E1B28_005564 Spliceosome [BR:more03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     E1B28_005564 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  66074640 NCBI-ProteinID:  XP_043011217 LinkDB All DBs Position 3:complement(800230..800702) Genome browser AA seq 95 aa AA seqDB search MSSLQGYVDKRVLLVLQDGRSIVGIMAGYDQKSNVVLSDSKERVYSMEEGVEEVPLGLYL VKGDMIILIGEIDENIDQAVDLSTIHAEPLPPIRH NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgtccagccttcaaggctatgtcgacaagcgcgttctgcttgttttgcaagatggaaga tcgatagtgggaataatggcaggttacgaccaaaaatcaaatgttgtgctttccgactcg aaagaaagagtttatagcatggaagagggcgtcgaagaggttccattgggcctgtatttg gtcaaaggcgacatgataatcctcatcggtgaaatagatgaaaacattgaccaagcagtc gacctctccacgattcacgcagaaccattaccaccaattcgacattag

DBGET integrated database retrieval system