Marasmius oreades (fairy-ring mushroom): E1B28_008599 Help Entry E1B28_008599      CDS       T08156                                  Symbol ATG8 Name (RefSeq) ubiquitin-like protein atg8   KO K08341   GABA(A) receptor-associated protein Organism more  Marasmius oreades (fairy-ring mushroom) Pathway more04136   Autophagy - other more04138   Autophagy - yeast more04139   Mitophagy - yeast Brite KEGG Orthology (KO) [BR:more00001]  09140 Cellular Processes   09141 Transport and catabolism    04138 Autophagy - yeast     E1B28_008599 (ATG8)    04136 Autophagy - other     E1B28_008599 (ATG8)    04139 Mitophagy - yeast     E1B28_008599 (ATG8)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:more04131]     E1B28_008599 (ATG8)    04121 Ubiquitin system [BR:more04121]     E1B28_008599 (ATG8)    03029 Mitochondrial biogenesis [BR:more03029]     E1B28_008599 (ATG8) Membrane trafficking [BR:more04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     E1B28_008599 (ATG8) Ubiquitin system [BR:more04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    E1B28_008599 (ATG8) Mitochondrial biogenesis [BR:more03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     E1B28_008599 (ATG8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATG8 APG12 Motif Other DBs NCBI-GeneID:  66077675 NCBI-ProteinID:  XP_043008703 UniProt:  A0A9P7S0B8 LinkDB All DBs Position 5:1747688..1748611 Genome browser AA seq 124 aa AA seqDB search MRSKFKDEHPFEKRKAEAERIRQKYPDRIPVICEKADKTDIPTIDKKKYLVPSDLTVGQF VYVIRKRIKLAPEKAIFIFVDEVLPPTAALMSAIYEEHKDEDNFLYVSYSGENTFGSESW TSEI NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgagatctaaattcaaagacgaacacccattcgagaaacgcaaggcagaagcagagcgt attcgacagaaataccccgatcgtatcccggtcatctgtgagaaggcggataaaaccgac atccccacaattgacaagaagaaatatcttgtcccttctgacttgaccgtgggccaattt gtttatgttattcggaaacgtatcaaactggcacctgagaaggcgatatttatcttcgtc gacgaggtcttaccgccgacagcggcactgatgagcgctatatatgaggagcacaaggac gaagacaacttcctttacgtcagctactccggcgaaaacactttcggttctgaaagttgg acctcggagatatga

DBGET integrated database retrieval system