KEGG   Microtus oregoni (creeping vole): 121432747
Entry
121432747         CDS       T08307                                 
Name
(RefSeq) calmodulin-like protein 3
  KO
K02183  calmodulin
Organism
morg  Microtus oregoni (creeping vole)
Pathway
morg04014  Ras signaling pathway
morg04015  Rap1 signaling pathway
morg04020  Calcium signaling pathway
morg04022  cGMP-PKG signaling pathway
morg04024  cAMP signaling pathway
morg04070  Phosphatidylinositol signaling system
morg04114  Oocyte meiosis
morg04218  Cellular senescence
morg04261  Adrenergic signaling in cardiomyocytes
morg04270  Vascular smooth muscle contraction
morg04371  Apelin signaling pathway
morg04625  C-type lectin receptor signaling pathway
morg04713  Circadian entrainment
morg04720  Long-term potentiation
morg04722  Neurotrophin signaling pathway
morg04728  Dopaminergic synapse
morg04740  Olfactory transduction
morg04744  Phototransduction
morg04750  Inflammatory mediator regulation of TRP channels
morg04910  Insulin signaling pathway
morg04912  GnRH signaling pathway
morg04915  Estrogen signaling pathway
morg04916  Melanogenesis
morg04921  Oxytocin signaling pathway
morg04922  Glucagon signaling pathway
morg04924  Renin secretion
morg04925  Aldosterone synthesis and secretion
morg04970  Salivary secretion
morg04971  Gastric acid secretion
morg05010  Alzheimer disease
morg05012  Parkinson disease
morg05022  Pathways of neurodegeneration - multiple diseases
morg05031  Amphetamine addiction
morg05034  Alcoholism
morg05133  Pertussis
morg05152  Tuberculosis
morg05163  Human cytomegalovirus infection
morg05167  Kaposi sarcoma-associated herpesvirus infection
morg05170  Human immunodeficiency virus 1 infection
morg05200  Pathways in cancer
morg05214  Glioma
morg05417  Lipid and atherosclerosis
morg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:morg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    121432747
   04015 Rap1 signaling pathway
    121432747
   04371 Apelin signaling pathway
    121432747
   04020 Calcium signaling pathway
    121432747
   04070 Phosphatidylinositol signaling system
    121432747
   04024 cAMP signaling pathway
    121432747
   04022 cGMP-PKG signaling pathway
    121432747
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    121432747
   04218 Cellular senescence
    121432747
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    121432747
  09152 Endocrine system
   04910 Insulin signaling pathway
    121432747
   04922 Glucagon signaling pathway
    121432747
   04912 GnRH signaling pathway
    121432747
   04915 Estrogen signaling pathway
    121432747
   04921 Oxytocin signaling pathway
    121432747
   04916 Melanogenesis
    121432747
   04924 Renin secretion
    121432747
   04925 Aldosterone synthesis and secretion
    121432747
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    121432747
   04270 Vascular smooth muscle contraction
    121432747
  09154 Digestive system
   04970 Salivary secretion
    121432747
   04971 Gastric acid secretion
    121432747
  09156 Nervous system
   04728 Dopaminergic synapse
    121432747
   04720 Long-term potentiation
    121432747
   04722 Neurotrophin signaling pathway
    121432747
  09157 Sensory system
   04744 Phototransduction
    121432747
   04740 Olfactory transduction
    121432747
   04750 Inflammatory mediator regulation of TRP channels
    121432747
  09159 Environmental adaptation
   04713 Circadian entrainment
    121432747
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    121432747
  09162 Cancer: specific types
   05214 Glioma
    121432747
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    121432747
   05163 Human cytomegalovirus infection
    121432747
   05167 Kaposi sarcoma-associated herpesvirus infection
    121432747
  09171 Infectious disease: bacterial
   05133 Pertussis
    121432747
   05152 Tuberculosis
    121432747
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    121432747
   05012 Parkinson disease
    121432747
   05022 Pathways of neurodegeneration - multiple diseases
    121432747
  09165 Substance dependence
   05031 Amphetamine addiction
    121432747
   05034 Alcoholism
    121432747
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    121432747
   05418 Fluid shear stress and atherosclerosis
    121432747
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:morg01009]
    121432747
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:morg04131]
    121432747
   03036 Chromosome and associated proteins [BR:morg03036]
    121432747
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:morg04147]
    121432747
Protein phosphatases and associated proteins [BR:morg01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     121432747
Membrane trafficking [BR:morg04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    121432747
Chromosome and associated proteins [BR:morg03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     121432747
Exosome [BR:morg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   121432747
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg UPF0154 EFhand_Ca_insen DUF5580_M EF-hand_11 Dockerin_1 RNA_pol_Rpb4 Caleosin FCaBP_EF-hand DUF1103 SurA_N_3 SurA_N_2 RFC1
Other DBs
NCBI-GeneID: 121432747
NCBI-ProteinID: XP_041486836
LinkDB
Position
Unknown
AA seq 149 aa
MTNQLTEEQIAEFKEAFSLFDKDGDGCITTQELGTVMRSLGQNPTEAELQGMVNEIDKDG
NGTVDFPEFLSMMSRKMKDTDSEEEIREAFRVFDKDGNGYVSAAELRHVMTRLGEKLSDE
EVEEMIRAADTDGDGQVNYEEFVHMLVSK
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaccaaccagctgactgaggagcaaatcgctgagttcaaggaggccttctctctgttt
gacaaggatggggacggctgcatcaccacccaggaactgggcactgtcatgcggtccctg
ggtcagaaccccacggaggctgagctccagggcatggtgaatgaaatcgacaaggatgga
aacggcactgtagacttcccggagttcctgagcatgatgtccaggaagatgaaagacacc
gacagcgaggaggagatccgggaggccttccgggtgttcgacaaggatggcaacggctat
gtcagtgctgctgagctgaggcatgtgatgaccaggctgggggagaagctgagtgacgag
gaggtggaggaaatgatacgggcagcagatacagatggcgatgggcaagtgaactatgag
gagtttgtccacatgctcgtatccaagtga

DBGET integrated database retrieval system