Microtus oregoni (creeping vole): 121434135 Help Entry 121434135         CDS       T08307                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism morg  Microtus oregoni (creeping vole) Pathway morg04613   Neutrophil extracellular trap formation morg05034   Alcoholism morg05203   Viral carcinogenesis morg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:morg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     121434135  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     121434135   09163 Immune disease    05322 Systemic lupus erythematosus     121434135   09165 Substance dependence    05034 Alcoholism     121434135  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:morg03036]     121434135 Chromosome and associated proteins [BR:morg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     121434135 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  121434135 NCBI-ProteinID:  XP_041488885 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaagggcgggaaaggcctgggcaaaggaggcgccaagcgccacagg aaggtcctgcgcgacaacatccagggcatcaccaagcccgccatccgccgcctggcccgg cgcggaggagtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctgaag gtgttcctggagaacgtgatccgcgacgcggtcacctacacggagcacgccaagcgcaag accgtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctatggc ttcggaggttaa

DBGET integrated database retrieval system