Microtus oregoni (creeping vole): 121435317 Help Entry 121435317         CDS       T08307                                  Symbol Csnk2b Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism morg  Microtus oregoni (creeping vole) Pathway morg03008   Ribosome biogenesis in eukaryotes morg03083   Polycomb repressive complex morg04064   NF-kappa B signaling pathway morg04137   Mitophagy - animal morg04310   Wnt signaling pathway morg04520   Adherens junction morg05010   Alzheimer disease morg05020   Prion disease morg05022   Pathways of neurodegeneration - multiple diseases morg05162   Measles morg05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:morg00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     121435317 (Csnk2b)   09126 Chromosome    03083 Polycomb repressive complex     121435317 (Csnk2b)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     121435317 (Csnk2b)    04064 NF-kappa B signaling pathway     121435317 (Csnk2b)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     121435317 (Csnk2b)   09144 Cellular community - eukaryotes    04520 Adherens junction     121435317 (Csnk2b)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     121435317 (Csnk2b)   09172 Infectious disease: viral    05162 Measles     121435317 (Csnk2b)   09164 Neurodegenerative disease    05010 Alzheimer disease     121435317 (Csnk2b)    05020 Prion disease     121435317 (Csnk2b)    05022 Pathways of neurodegeneration - multiple diseases     121435317 (Csnk2b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:morg03009]     121435317 (Csnk2b)    03036 Chromosome and associated proteins [BR:morg03036]     121435317 (Csnk2b) Ribosome biogenesis [BR:morg03009]  Eukaryotic type   90S particles    Kinase     121435317 (Csnk2b) Chromosome and associated proteins [BR:morg03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      121435317 (Csnk2b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  121435317 NCBI-ProteinID:  XP_041490494 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagtagctctgaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa ttcttctgtgaggtggatgaagactacatccaggacaagtttaatctcactgggctcaat gagcaggtgcctcactatcgacaagctctagacatgatcctggacctggagcctgatgaa gagctggaggacaaccccaaccagagtgacctgattgaacaggcagcggagatgctttat gggttgatccacgcccgctacatcctcaccaaccgaggcatcgcccaaatgttggaaaag taccagcagggagactttggctactgtcctcgtgtatactgtgagaatcagccgatgctt ccgattggcctttcggacatcccaggcgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacccccaaatcatcacggcaccatcacaccgacggcgcctacttcggc actggcttcccccacatgctcttcatggtgcacccagagtaccggcccaaacgacccgcc aaccagtttgtacccaggctctatggtttcaagattcatccaatggcttaccagctgcag ctccaagccgccagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system