Microtus oregoni (creeping vole): 121435570 Help Entry 121435570         CDS       T08307                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism morg  Microtus oregoni (creeping vole) Pathway morg04382   Cornified envelope formation morg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:morg00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     121435570  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121435570  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:morg04147]     121435570 Exosome [BR:morg04147]  Exosomal proteins   Exosomal proteins of microglial cells    121435570 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EFhand_Ca_insen EF-hand_1 EF-hand_8 Motif Other DBs NCBI-GeneID:  121435570 NCBI-ProteinID:  XP_041490952 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHTMETMMLTFHRFAGDKDYLTKEDLRVLMEREFPGFLENQKDPMAVDKIMKDLD QCRDGKVGFQSFLSLVAGLIIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccttctcagatggagcacaccatggaaaccatgatgctgacattccacagatttgca ggggacaaagactacttgacaaaggaggacctgagagtgctcatggaaagggagttccct gggtttttggaaaatcaaaaggaccccatggctgtggacaaaataatgaaggacctggac cagtgccgagacggcaaagtcggcttccagagctttctgtcactagttgcagggctcatc attgcgtgcaatgactattttgtagtacacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system