Microtus oregoni (creeping vole): 121435807 Help Entry 121435807         CDS       T08307                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism morg  Microtus oregoni (creeping vole) Pathway morg04613   Neutrophil extracellular trap formation morg05034   Alcoholism morg05202   Transcriptional misregulation in cancer morg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:morg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     121435807  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     121435807   09163 Immune disease    05322 Systemic lupus erythematosus     121435807   09165 Substance dependence    05034 Alcoholism     121435807  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:morg03036]     121435807   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:morg04147]     121435807 Chromosome and associated proteins [BR:morg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     121435807 Exosome [BR:morg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121435807 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  121435807 NCBI-ProteinID:  XP_041491194 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtactaagcagactgcccgtaaatccaccggtggtaaagcacccaggaaacaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaatcagacgctatcagaaatccactgaa cttctgatccgcaaactccccttccagcgtctggtgcgagaaattgctcaggacttcaaa acagatctgcgcttccagagtgcggctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagataccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagatatccagctagcacgccgcatacgcggagaacgtgcttaa

DBGET integrated database retrieval system