Microtus oregoni (creeping vole): 121438012 Help Entry 121438012         CDS       T08307                                  Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism morg  Microtus oregoni (creeping vole) Pathway morg04382   Cornified envelope formation morg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:morg00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     121438012  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121438012  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:morg04147]     121438012 Exosome [BR:morg04147]  Exosomal proteins   Exosomal proteins of microglial cells    121438012 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 Motif Other DBs NCBI-GeneID:  121438012 NCBI-ProteinID:  XP_041494116 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETMMLTFHRFAGDKDYLTKEDLRVLMEREFPGFLENQKDPMAVDKIMKDLD QCRDGKVGFQSFLSLVAGLIIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccttctcagatggagcacgccatggaaaccatgatgctgacattccacagatttgca ggggacaaagactacttgacaaaggaggacctgagagtgctcatggaaagggagttccct gggtttttggaaaatcaaaaggaccccatggctgtggacaaaataatgaaggacctggac cagtgccgagacggcaaagtcggcttccagagctttctgtcactagttgcagggctcatc attgcgtgcaatgactattttgtagtacacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system