Microtus oregoni (creeping vole): 121439556 Help Entry 121439556         CDS       T08307                                  Name (RefSeq) profilin-4   KO K05759   profilin Organism morg  Microtus oregoni (creeping vole) Pathway morg04015   Rap1 signaling pathway morg04810   Regulation of actin cytoskeleton morg05014   Amyotrophic lateral sclerosis morg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     121439556  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     121439556  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121439556   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     121439556  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:morg04131]     121439556   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:morg04812]     121439556    04147 Exosome [BR:morg04147]     121439556 Membrane trafficking [BR:morg04131]  Others   Actin-binding proteins    Others     121439556 Cytoskeleton proteins [BR:morg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      121439556 Exosome [BR:morg04147]  Exosomal proteins   Proteins found in most exosomes    121439556 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  121439556 NCBI-ProteinID:  XP_041496004 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCMTSPGFNVMPSDVRTLVNGFAKNPLITR REGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTHLYLLVATYTAGMYPSVCVEATEKL GDYLRKKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagtcatttacaaaacttactgttagacaccttgctggggacaaagcatgtggacagt gccgccctcatcaaactccaagaaaggagcctgtgtatgacatcaccaggatttaatgta atgccaagtgatgttcgaacacttgtgaatggatttgccaaaaacccactgataacccga agggaaggcttgtacttcaaggaaaaggattacaaatgtgtccgggcagatgactattct ctttatgctaagaatgagaacactggtgtggtggttgtgaagacccatctgtatcttctg gtggccacttacactgcaggcatgtatcctagcgtctgtgtggaggccacagagaagctg ggagactatctaagaaagaaaggaaactaa

DBGET integrated database retrieval system