Microtus oregoni (creeping vole): 121442308 Help Entry 121442308         CDS       T08307                                  Symbol Gast Name (RefSeq) gastrin   KO K13768   gastrin Organism morg  Microtus oregoni (creeping vole) Pathway morg04081   Hormone signaling morg04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     121442308 (Gast)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     121442308 (Gast)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121442308 (Gast) Cytokines and neuropeptides [BR:morg04052]  Neuropeptides   GPCR binding    121442308 (Gast) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  121442308 NCBI-ProteinID:  XP_041499729 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MFRLCVCMLILVLALATFSEASWKPHSHLQDASSGPGANRGLELHQLAQLDPASHHRRQL GPQGPQHFITDLSKKQMPRMEEEEEAYGWMDFGRRSAEEGDQRN NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgtttcgactgtgcgtgtgcatgctgatcttagtcctggctctggctaccttctctgaa gcttcttggaagccccactcccatctacaggatgcatcctctggaccaggggccaacagg ggcctggaactacatcagctggcccagctggacccagcctctcaccatcgaaggcagctg gggccccagggtcctcaacacttcataacagacctgtccaagaagcagatgccaaggatg gaggaagaagaagaggcgtatggatggatggactttggccgccgcagtgctgaggaaggg gaccagcgtaactag

DBGET integrated database retrieval system