Microtus oregoni (creeping vole): 121442588 Help Entry 121442588         CDS       T08307                                  Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism morg  Microtus oregoni (creeping vole) Pathway morg04814   Motor proteins morg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:morg00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     121442588  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121442588  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:morg03037]     121442588    04812 Cytoskeleton proteins [BR:morg04812]     121442588 Cilium and associated proteins [BR:morg03037]  Motile cilia and associated proteins   Dynein arm    121442588 Cytoskeleton proteins [BR:morg04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      121442588 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  121442588 NCBI-ProteinID:  XP_041500117 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MEVYHRPCDEGGFNAEEAHNVVKECVDAVLGGEDYNHNNINQWTASIVEQSLAHLVKMGK AYKYIVTCAVAQRSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNIFAIAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggtgtaccaccggccctgcgacgagggtggcttcaatgctgaggaagcgcataat gtcgtcaaagagtgtgttgatgcagtgttgggaggcgaggactacaatcataacaacatc aaccaatggactgcaagcatagtggagcaatccctagcacatttggttaaaatgggcaaa gcttataagtacattgtgacctgtgctgtggcccagaggagtgcctatggatttcataca gccagctcatgcttttgggatactacatctgatggaacctgtactgtaagatgggagaac cgtaccatgaactgtattgttaatatctttgcaattgcaattgtcctgtaa

DBGET integrated database retrieval system