Microtus oregoni (creeping vole): 121447149 Help Entry 121447149         CDS       T08307                                  Symbol Ccl22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism morg  Microtus oregoni (creeping vole) Pathway morg04060   Cytokine-cytokine receptor interaction morg04061   Viral protein interaction with cytokine and cytokine receptor morg04062   Chemokine signaling pathway morg04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121447149 (Ccl22)    04061 Viral protein interaction with cytokine and cytokine receptor     121447149 (Ccl22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121447149 (Ccl22)    04062 Chemokine signaling pathway     121447149 (Ccl22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121447149 (Ccl22) Cytokines and neuropeptides [BR:morg04052]  Cytokines   Chemokines    121447149 (Ccl22) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Calc_CGRP_IAPP Motif Other DBs NCBI-GeneID:  121447149 NCBI-ProteinID:  XP_041506166 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search MASLRTLLLLTLVLLAVVIQTPDAAPYGTNMEDSICCQDYMRHPLPARVVKEYFWTSKSC RKPGIVLITIKNRDICADPRMHWVKRLLHKLT NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgcggactctgctcctcctaactctcgttcttctcgctgtggtcattcag acgcctgatgcagctccctacggtaccaacatggaagacagcatctgctgccaggactac atgcgtcaccccctgccagcacgtgtagtgaaggagtacttctggacctccaagtcctgc cgcaagcctggcattgttttgataaccatcaagaaccgggacatctgtgctgaccccagg atgcactgggtgaagagacttctccataagctgacctag

DBGET integrated database retrieval system