Microtus oregoni (creeping vole): 121447238 Help Entry 121447238         CDS       T08307                                  Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism morg  Microtus oregoni (creeping vole) Pathway morg04978   Mineral absorption Brite KEGG Orthology (KO) [BR:morg00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     121447238  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:morg03019]     121447238    03029 Mitochondrial biogenesis [BR:morg03029]     121447238 Messenger RNA biogenesis [BR:morg03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      121447238 Mitochondrial biogenesis [BR:morg03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     121447238 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  121447238 NCBI-ProteinID:  XP_041506310 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPNCSCATDGSCSCAGSCKCKQCKCTTCKKSCCSCCPVGCAKCSQGCICKEASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgtgccacagatggatcctgctcctgcgccgggtcttgcaaa tgcaaacagtgcaaatgcaccacctgcaagaaaagctgctgctcctgttgccccgtgggc tgcgcgaagtgctctcagggctgcatctgtaaggaagcttcagacaagtgcagctgctgc gcctga

DBGET integrated database retrieval system