Microtus oregoni (creeping vole): 121447462 Help Entry 121447462         CDS       T08307                                  Symbol Nppc Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism morg  Microtus oregoni (creeping vole) Pathway morg04022   cGMP-PKG signaling pathway morg04081   Hormone signaling morg04270   Vascular smooth muscle contraction morg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     121447462 (Nppc)   09133 Signaling molecules and interaction    04081 Hormone signaling     121447462 (Nppc)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     121447462 (Nppc)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     121447462 (Nppc)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121447462 (Nppc) Cytokines and neuropeptides [BR:morg04052]  Neuropeptides   Unclassified    121447462 (Nppc) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  121447462 NCBI-ProteinID:  XP_041506667 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MHLSQLIACALLLTLLSLRLSEAKPGTPPKGPRTPPGEELAEPQAAGGNQKKGDKTPGSG GANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgatcgcctgtgccctgctgctaacgctactctcactccggctc tccgaggccaagcccgggacgccaccaaagggcccgcgaacccctccaggggaggagctg gcggagccccaggcagctggtggcaatcagaaaaaaggtgacaagactccaggcagcgga ggcgccaatctcaagggagaccgatcgcgactgctccgggacctgcgcgtggacaccaag tcccgggctgcttgggcccgccttctgcacgagcaccccaacgcgcgcaaatacaaaggc ggcaacaagaagggcttgtccaaaggctgctttggcctcaagctggaccggatcggctcc atgagcggtctgggatgttag

DBGET integrated database retrieval system