Microtus oregoni (creeping vole): 121447945 Help Entry 121447945         CDS       T08307                                  Name (RefSeq) centromere protein S-like   KO K11511   centromere protein S Organism morg  Microtus oregoni (creeping vole) Pathway morg03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:morg00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     121447945  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:morg03036]     121447945    03400 DNA repair and recombination proteins [BR:morg03400]     121447945 Chromosome and associated proteins [BR:morg03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      121447945 DNA repair and recombination proteins [BR:morg03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      121447945 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Histone TFIID-31kDa Bromo_TP COMMD1_N Chap-C TAF Motif Other DBs NCBI-GeneID:  121447945 NCBI-ProteinID:  XP_041507232 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MEETEAEEERQFSHRQRLKAAVHYTVGSLCNEVALDKQVQFNKQTVAALAEVTFRQCENF AKDLEMFARHAKRSTVTTEDVKLLARRSNSLLKYITEKNEEIAQLNLERKAKKKRKPEDE SSNSRESAAEVVDTET NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggaggagacggaggcggaggaggagcggcagttctctcaccggcagaggctaaaggca gcagttcactacacggtcggcagtctgtgcaatgaagtggccttggacaaacaggtgcag ttcaacaagcagaccgtggcagccctcgcggaggtgactttccgacagtgcgaaaatttt gccaaagaccttgagatgtttgccagacacgcgaaaagaagcacagttaccactgaggac gtgaagctcttagccaggcggagtaattcactgctaaaatacatcacagagaaaaacgaa gagattgctcagctcaacctagagcgaaaggccaagaagaaaaggaagccagaggatgag agcagtaactccagggagtccgctgccgaagtggtggacactgagacttga

DBGET integrated database retrieval system