Microtus oregoni (creeping vole): 121448148 Help Entry 121448148         CDS       T08307                                  Symbol Jun Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism morg  Microtus oregoni (creeping vole) Pathway morg01522   Endocrine resistance morg04010   MAPK signaling pathway morg04012   ErbB signaling pathway morg04024   cAMP signaling pathway morg04137   Mitophagy - animal morg04210   Apoptosis morg04310   Wnt signaling pathway morg04380   Osteoclast differentiation morg04510   Focal adhesion morg04530   Tight junction morg04620   Toll-like receptor signaling pathway morg04621   NOD-like receptor signaling pathway morg04625   C-type lectin receptor signaling pathway morg04657   IL-17 signaling pathway morg04658   Th1 and Th2 cell differentiation morg04659   Th17 cell differentiation morg04660   T cell receptor signaling pathway morg04662   B cell receptor signaling pathway morg04668   TNF signaling pathway morg04722   Neurotrophin signaling pathway morg04912   GnRH signaling pathway morg04915   Estrogen signaling pathway morg04921   Oxytocin signaling pathway morg04926   Relaxin signaling pathway morg04932   Non-alcoholic fatty liver disease morg04933   AGE-RAGE signaling pathway in diabetic complications morg05030   Cocaine addiction morg05031   Amphetamine addiction morg05132   Salmonella infection morg05133   Pertussis morg05135   Yersinia infection morg05140   Leishmaniasis morg05142   Chagas disease morg05161   Hepatitis B morg05162   Measles morg05166   Human T-cell leukemia virus 1 infection morg05167   Kaposi sarcoma-associated herpesvirus infection morg05169   Epstein-Barr virus infection morg05170   Human immunodeficiency virus 1 infection morg05171   Coronavirus disease - COVID-19 morg05200   Pathways in cancer morg05203   Viral carcinogenesis morg05207   Chemical carcinogenesis - receptor activation morg05208   Chemical carcinogenesis - reactive oxygen species morg05210   Colorectal cancer morg05211   Renal cell carcinoma morg05224   Breast cancer morg05231   Choline metabolism in cancer morg05235   PD-L1 expression and PD-1 checkpoint pathway in cancer morg05321   Inflammatory bowel disease morg05323   Rheumatoid arthritis morg05417   Lipid and atherosclerosis morg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121448148 (Jun)    04012 ErbB signaling pathway     121448148 (Jun)    04310 Wnt signaling pathway     121448148 (Jun)    04668 TNF signaling pathway     121448148 (Jun)    04024 cAMP signaling pathway     121448148 (Jun)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     121448148 (Jun)   09143 Cell growth and death    04210 Apoptosis     121448148 (Jun)   09144 Cellular community - eukaryotes    04510 Focal adhesion     121448148 (Jun)    04530 Tight junction     121448148 (Jun)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121448148 (Jun)    04621 NOD-like receptor signaling pathway     121448148 (Jun)    04625 C-type lectin receptor signaling pathway     121448148 (Jun)    04660 T cell receptor signaling pathway     121448148 (Jun)    04658 Th1 and Th2 cell differentiation     121448148 (Jun)    04659 Th17 cell differentiation     121448148 (Jun)    04657 IL-17 signaling pathway     121448148 (Jun)    04662 B cell receptor signaling pathway     121448148 (Jun)   09152 Endocrine system    04912 GnRH signaling pathway     121448148 (Jun)    04915 Estrogen signaling pathway     121448148 (Jun)    04921 Oxytocin signaling pathway     121448148 (Jun)    04926 Relaxin signaling pathway     121448148 (Jun)   09156 Nervous system    04722 Neurotrophin signaling pathway     121448148 (Jun)   09158 Development and regeneration    04380 Osteoclast differentiation     121448148 (Jun)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121448148 (Jun)    05207 Chemical carcinogenesis - receptor activation     121448148 (Jun)    05208 Chemical carcinogenesis - reactive oxygen species     121448148 (Jun)    05203 Viral carcinogenesis     121448148 (Jun)    05231 Choline metabolism in cancer     121448148 (Jun)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     121448148 (Jun)   09162 Cancer: specific types    05210 Colorectal cancer     121448148 (Jun)    05211 Renal cell carcinoma     121448148 (Jun)    05224 Breast cancer     121448148 (Jun)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121448148 (Jun)    05170 Human immunodeficiency virus 1 infection     121448148 (Jun)    05161 Hepatitis B     121448148 (Jun)    05171 Coronavirus disease - COVID-19     121448148 (Jun)    05162 Measles     121448148 (Jun)    05167 Kaposi sarcoma-associated herpesvirus infection     121448148 (Jun)    05169 Epstein-Barr virus infection     121448148 (Jun)   09171 Infectious disease: bacterial    05132 Salmonella infection     121448148 (Jun)    05135 Yersinia infection     121448148 (Jun)    05133 Pertussis     121448148 (Jun)   09174 Infectious disease: parasitic    05140 Leishmaniasis     121448148 (Jun)    05142 Chagas disease     121448148 (Jun)   09163 Immune disease    05323 Rheumatoid arthritis     121448148 (Jun)    05321 Inflammatory bowel disease     121448148 (Jun)   09165 Substance dependence    05030 Cocaine addiction     121448148 (Jun)    05031 Amphetamine addiction     121448148 (Jun)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121448148 (Jun)    05418 Fluid shear stress and atherosclerosis     121448148 (Jun)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     121448148 (Jun)    04933 AGE-RAGE signaling pathway in diabetic complications     121448148 (Jun)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     121448148 (Jun)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:morg03000]     121448148 (Jun) Transcription factors [BR:morg03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     121448148 (Jun) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf Rab11-FIP3 MIC19_MIC25 RIMB1_N ZapB CCDC192 PspA_IM30 Fib_alpha ATG16 TFIIA T4SS_LegC2C7 DUF3450 FlaC_arch Map3k7cl VPA1267 Motif Other DBs NCBI-GeneID:  121448148 NCBI-ProteinID:  XP_041507862 LinkDB All DBs Position Unknown AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGA LSSGGAPSYGAAGLAFPSQPQQQQQQPPQPPHHLAQQIPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggcgcctacggctacagtaaccctaagatcctgaaacagagcatgaccttg aacctggccgacccggtgggcaatctgaagccgcacctccgcgccaagaactcggacctc ctcacgtcgcccgacgttgggctgcttaagctggcgtcgcccgaactggagcgcctgatc atccagtccagcaatggacacatcaccaccacgccgacccccacccagttcttgtgcccc aagaacgtgaccgacgagcaggagggcttcgcagagggcttcgtgcgcgccctggccgaa ctgcatagccagaacacgctgcccagcgtcacgtccgcggcacagccggtcagcggggcg ggcatggtggctcccgcggtggcatcggtagccggcgctggcggtggcggcggctatagc gccagcctgcacagcgagcctccggtctacgccaacctcagcaacttcaacccgggtgcg ctgagcagcggcggggcgccctcctacggcgcggccgggctggcttttccgtcgcagccc cagcagcagcagcagcagccgcctcagccgccgcaccacttggcccaacagatcccggtg cagcacccccggctgcaggccctgaaggaagagccacagacggtgcccgagatgccggga gaaaccccgcccctgtcccccatcgacatggagtctcaggagcggatcaaggcggagagg aagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagaggatc gcccgactagaggaaaaagtgaaaaccttgaaagcgcaaaactcggagctggcgtccacg gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccagctcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system