Microtus oregoni (creeping vole): 121448501 Help Entry 121448501         CDS       T08307                                  Name (RefSeq) interferon alpha-12-like   KO K05414   interferon alpha Organism morg  Microtus oregoni (creeping vole) Pathway morg04060   Cytokine-cytokine receptor interaction morg04151   PI3K-Akt signaling pathway morg04217   Necroptosis morg04620   Toll-like receptor signaling pathway morg04621   NOD-like receptor signaling pathway morg04622   RIG-I-like receptor signaling pathway morg04623   Cytosolic DNA-sensing pathway morg04630   JAK-STAT signaling pathway morg04650   Natural killer cell mediated cytotoxicity morg04936   Alcoholic liver disease morg05152   Tuberculosis morg05160   Hepatitis C morg05161   Hepatitis B morg05162   Measles morg05163   Human cytomegalovirus infection morg05164   Influenza A morg05165   Human papillomavirus infection morg05167   Kaposi sarcoma-associated herpesvirus infection morg05168   Herpes simplex virus 1 infection morg05169   Epstein-Barr virus infection morg05170   Human immunodeficiency virus 1 infection morg05171   Coronavirus disease - COVID-19 morg05200   Pathways in cancer morg05320   Autoimmune thyroid disease morg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     121448501    04151 PI3K-Akt signaling pathway     121448501   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121448501  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     121448501  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121448501    04621 NOD-like receptor signaling pathway     121448501    04622 RIG-I-like receptor signaling pathway     121448501    04623 Cytosolic DNA-sensing pathway     121448501    04650 Natural killer cell mediated cytotoxicity     121448501  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121448501   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     121448501    05161 Hepatitis B     121448501    05160 Hepatitis C     121448501    05171 Coronavirus disease - COVID-19     121448501    05164 Influenza A     121448501    05162 Measles     121448501    05168 Herpes simplex virus 1 infection     121448501    05163 Human cytomegalovirus infection     121448501    05167 Kaposi sarcoma-associated herpesvirus infection     121448501    05169 Epstein-Barr virus infection     121448501    05165 Human papillomavirus infection     121448501   09171 Infectious disease: bacterial    05152 Tuberculosis     121448501   09163 Immune disease    05320 Autoimmune thyroid disease     121448501   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121448501   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     121448501  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121448501 Cytokines and neuropeptides [BR:morg04052]  Cytokines   Interferons    121448501 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon RIX1 Motif Other DBs NCBI-GeneID:  121448501 NCBI-ProteinID:  XP_041508501 LinkDB All DBs Position Unknown AA seq 190 aa AA seqDB search MARPCAFLMALVLMSYWSTCSLGCDLPQTHNLRNKGALTLLAQMRRLSPLSCLKDREDFA FPLENVDAQQIQKAQAIPVLQELTQQVLILFSSENSSAAWETTLLDTFCTGLHQQLNDLQ ACLMQQLGVQEPPLSQEDSLVAVRKYFHRITVYLREKKHSVCAWEVVRAEIWRALSSSAK LLARLNVKKE NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atggccagaccctgtgctttcctgatggccctggtgctgatgagctactggtcaacctgc tctctgggatgtgacctgcctcagactcataacctcaggaacaagggagccttgacactc ctggcacaaatgaggagactctcccctctctcctgcctcaaggacagagaggactttgca ttccctctggagaacgtggatgcccagcagatccagaaggctcaagccatccctgtcctg caggaactgacccagcaggtcctcatcctcttcagctcagagaactcatctgctgcttgg gagacaaccctcctagacacattctgcactggcctccaccaacagctcaatgacctgcag gcctgtctgatgcagcagttgggggtgcaggaacctcccctgagccaggaagactccctg gttgctgtgaggaaatactttcacaggatcactgtctatctgagagagaagaaacacagt gtttgtgcctgggaggtggtcagagcagaaatctggagagccctgtcttcctcagccaag ttgctagcaagattgaacgtgaagaaggaataa

DBGET integrated database retrieval system