Microtus oregoni (creeping vole): 121450580 Help Entry 121450580         CDS       T08307                                  Symbol Rab5a Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism morg  Microtus oregoni (creeping vole) Pathway morg04014   Ras signaling pathway morg04137   Mitophagy - animal morg04144   Endocytosis morg04145   Phagosome morg04148   Efferocytosis morg04962   Vasopressin-regulated water reabsorption morg05014   Amyotrophic lateral sclerosis morg05022   Pathways of neurodegeneration - multiple diseases morg05132   Salmonella infection morg05146   Amoebiasis morg05152   Tuberculosis Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     121450580 (Rab5a)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121450580 (Rab5a)    04145 Phagosome     121450580 (Rab5a)    04137 Mitophagy - animal     121450580 (Rab5a)    04148 Efferocytosis     121450580 (Rab5a)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     121450580 (Rab5a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121450580 (Rab5a)    05152 Tuberculosis     121450580 (Rab5a)   09174 Infectious disease: parasitic    05146 Amoebiasis     121450580 (Rab5a)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     121450580 (Rab5a)    05022 Pathways of neurodegeneration - multiple diseases     121450580 (Rab5a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:morg04131]     121450580 (Rab5a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:morg04147]     121450580 (Rab5a)    04031 GTP-binding proteins [BR:morg04031]     121450580 (Rab5a) Membrane trafficking [BR:morg04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     121450580 (Rab5a)  Endosome - Lysosome transport     121450580 (Rab5a) Exosome [BR:morg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121450580 (Rab5a)   Exosomal proteins of other body fluids (saliva and urine)    121450580 (Rab5a)   Exosomal proteins of colorectal cancer cells    121450580 (Rab5a)   Exosomal proteins of bladder cancer cells    121450580 (Rab5a) GTP-binding proteins [BR:morg04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     121450580 (Rab5a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 BrnT_toxin MCR_beta Motif Other DBs NCBI-GeneID:  121450580 NCBI-ProteinID:  XP_041511623 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNLGTNSARGRGVDLTEPAQPARSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaatgggccaaatactgggaataaaatatgccag ttcaaactggtacttctaggagagtctgctgttggcaaatcaagcctggtgcttcgcttt gtgaagggccaatttcatgaatttcaagagagtaccattggggctgcctttctaacccaa actgtgtgtcttgatgacacaacagtaaaatttgaaatatgggatacagctggccaagaa cggtaccatagcctagcaccaatgtactaccgaggagcgcaagcagccatagttgtgtat gatatcacaaatgaggagtcctttgcaagagcaaaaaactgggttaaagaacttcagagg caagcaagtcctaatattgtgatagctttgtcaggaaacaaggctgacctagcaaataaa agagctgtagacttccaggaagcacagtcctatgcagatgacaacagtttattattcatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ctgccaaagaatgaaccacagaatctaggcacaaactcggccagaggacgaggagtagac cttactgagcctgcacagccagccagaagccagtgttgtagtaactga

DBGET integrated database retrieval system