Microtus oregoni (creeping vole): 121450805 Help Entry 121450805         CDS       T08307                                  Name (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism morg  Microtus oregoni (creeping vole) Pathway morg00480   Glutathione metabolism morg00980   Metabolism of xenobiotics by cytochrome P450 morg00982   Drug metabolism - cytochrome P450 morg00983   Drug metabolism - other enzymes morg01100   Metabolic pathways morg01524   Platinum drug resistance morg05200   Pathways in cancer morg05204   Chemical carcinogenesis - DNA adducts morg05215   Prostate cancer morg05225   Hepatocellular carcinoma morg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:morg00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     121450805   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     121450805    00982 Drug metabolism - cytochrome P450     121450805    00983 Drug metabolism - other enzymes     121450805  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121450805    05204 Chemical carcinogenesis - DNA adducts     121450805   09162 Cancer: specific types    05225 Hepatocellular carcinoma     121450805    05215 Prostate cancer     121450805   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     121450805   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     121450805  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:morg02000]     121450805 Enzymes [BR:morg01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      121450805 Transporters [BR:morg02000]  Other transporters   Pores ion channels [TC:1]    121450805 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 GST_C_2 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  121450805 NCBI-ProteinID:  XP_041512038 LinkDB All DBs Position Unknown AA seq 210 aa AA seqDB search MPPYTIVYFPVRGRCEAMRILLADQDQSWKEEVVSIDTWMKGLLKSTCLYGQLPKFQDGD LTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRLKYITLIYTKYEEGKDDYV KALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLLSAY VARLSARPKIKAFLSSPDHLNRPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccgccgtacaccattgtctacttcccagttcgagggcgctgtgaggccatgcgcata ctactggctgaccaggaccagagctggaaggaggaggtggtgtccatagatacttggatg aaaggcttgctcaagtccacctgtctgtatgggcagctccccaagtttcaggatggagac cttaccctgtaccaatctaatgccatcttgaggcacttgggccgatcccttgggctttat ggaaaagatcagaaggaggctgccctggtggatatggtgaatgatggggtggaagacctt cgcctgaaatacatcaccctcatctacaccaaatatgaggaagggaaggatgactatgtg aaggccctgcctggacacctgaaacctttcgagaccctgctgtcccagaaccaaggaggc aaagccttcatcgtgggtgaccagatctccttcgccgattacaacttgctagatctgctg ctgatccaccaggtcctggcccctggctgcctggacaacttccccctgctcagtgcctat gtggcacgcctcagtgcccggcccaagatcaaggccttcctgtcctcccctgaccatttg aaccgtcccatcaatggcaacggcaagcagtaa

DBGET integrated database retrieval system