Microtus oregoni (creeping vole): 121451093 Help Entry 121451093         CDS       T08307                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism morg  Microtus oregoni (creeping vole) Brite KEGG Orthology (KO) [BR:morg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:morg03041]     121451093   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121451093 Spliceosome [BR:morg03041]  Complex B   Other components    Complex B specific factors     121451093 Cytokines and neuropeptides [BR:morg04052]  Neuropeptides   Unclassified    121451093 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Rad60-SLD OTU1_UBXL PI3K_rbd DUF3967 Motif Other DBs NCBI-GeneID:  121451093 NCBI-ProteinID:  XP_041512529 LinkDB All DBs Position Unknown AA seq 74 aa AA seqDB search MMIEVVCNDRLGKKVRVKCDTDDTVQDLKKLIAAQTGTRWTKIVLKKWYTIFKDHVSLGD YEIHDGMNLELYYQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgatgattgaggtggtttgcaatgaccgtctggggaagaaagtccgcgtcaaatgtgac accgatgataccgtccaggacttgaaaaaactcatagcggcccaaactggcacccggtgg acgaagatagtcctgaaaaaatggtacacgatttttaaggaccacgtgtctctgggagat tatgaaatccatgatgggatgaacctggagctttattaccagtag

DBGET integrated database retrieval system