Microtus oregoni (creeping vole): 121452602 Help Entry 121452602         CDS       T08307                                  Symbol Nfkbia Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism morg  Microtus oregoni (creeping vole) Pathway morg04024   cAMP signaling pathway morg04062   Chemokine signaling pathway morg04064   NF-kappa B signaling pathway morg04210   Apoptosis morg04380   Osteoclast differentiation morg04620   Toll-like receptor signaling pathway morg04621   NOD-like receptor signaling pathway morg04622   RIG-I-like receptor signaling pathway morg04623   Cytosolic DNA-sensing pathway morg04625   C-type lectin receptor signaling pathway morg04657   IL-17 signaling pathway morg04658   Th1 and Th2 cell differentiation morg04659   Th17 cell differentiation morg04660   T cell receptor signaling pathway morg04662   B cell receptor signaling pathway morg04668   TNF signaling pathway morg04722   Neurotrophin signaling pathway morg04920   Adipocytokine signaling pathway morg04926   Relaxin signaling pathway morg04931   Insulin resistance morg04936   Alcoholic liver disease morg05132   Salmonella infection morg05134   Legionellosis morg05135   Yersinia infection morg05140   Leishmaniasis morg05142   Chagas disease morg05145   Toxoplasmosis morg05160   Hepatitis C morg05161   Hepatitis B morg05162   Measles morg05163   Human cytomegalovirus infection morg05164   Influenza A morg05166   Human T-cell leukemia virus 1 infection morg05167   Kaposi sarcoma-associated herpesvirus infection morg05168   Herpes simplex virus 1 infection morg05169   Epstein-Barr virus infection morg05170   Human immunodeficiency virus 1 infection morg05171   Coronavirus disease - COVID-19 morg05200   Pathways in cancer morg05203   Viral carcinogenesis morg05208   Chemical carcinogenesis - reactive oxygen species morg05215   Prostate cancer morg05220   Chronic myeloid leukemia morg05222   Small cell lung cancer morg05235   PD-L1 expression and PD-1 checkpoint pathway in cancer morg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     121452602 (Nfkbia)    04668 TNF signaling pathway     121452602 (Nfkbia)    04024 cAMP signaling pathway     121452602 (Nfkbia)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     121452602 (Nfkbia)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121452602 (Nfkbia)    04621 NOD-like receptor signaling pathway     121452602 (Nfkbia)    04622 RIG-I-like receptor signaling pathway     121452602 (Nfkbia)    04623 Cytosolic DNA-sensing pathway     121452602 (Nfkbia)    04625 C-type lectin receptor signaling pathway     121452602 (Nfkbia)    04660 T cell receptor signaling pathway     121452602 (Nfkbia)    04658 Th1 and Th2 cell differentiation     121452602 (Nfkbia)    04659 Th17 cell differentiation     121452602 (Nfkbia)    04657 IL-17 signaling pathway     121452602 (Nfkbia)    04662 B cell receptor signaling pathway     121452602 (Nfkbia)    04062 Chemokine signaling pathway     121452602 (Nfkbia)   09152 Endocrine system    04920 Adipocytokine signaling pathway     121452602 (Nfkbia)    04926 Relaxin signaling pathway     121452602 (Nfkbia)   09156 Nervous system    04722 Neurotrophin signaling pathway     121452602 (Nfkbia)   09158 Development and regeneration    04380 Osteoclast differentiation     121452602 (Nfkbia)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121452602 (Nfkbia)    05208 Chemical carcinogenesis - reactive oxygen species     121452602 (Nfkbia)    05203 Viral carcinogenesis     121452602 (Nfkbia)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     121452602 (Nfkbia)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     121452602 (Nfkbia)    05215 Prostate cancer     121452602 (Nfkbia)    05222 Small cell lung cancer     121452602 (Nfkbia)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121452602 (Nfkbia)    05170 Human immunodeficiency virus 1 infection     121452602 (Nfkbia)    05161 Hepatitis B     121452602 (Nfkbia)    05160 Hepatitis C     121452602 (Nfkbia)    05171 Coronavirus disease - COVID-19     121452602 (Nfkbia)    05164 Influenza A     121452602 (Nfkbia)    05162 Measles     121452602 (Nfkbia)    05168 Herpes simplex virus 1 infection     121452602 (Nfkbia)    05163 Human cytomegalovirus infection     121452602 (Nfkbia)    05167 Kaposi sarcoma-associated herpesvirus infection     121452602 (Nfkbia)    05169 Epstein-Barr virus infection     121452602 (Nfkbia)   09171 Infectious disease: bacterial    05132 Salmonella infection     121452602 (Nfkbia)    05135 Yersinia infection     121452602 (Nfkbia)    05134 Legionellosis     121452602 (Nfkbia)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     121452602 (Nfkbia)    05140 Leishmaniasis     121452602 (Nfkbia)    05142 Chagas disease     121452602 (Nfkbia)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121452602 (Nfkbia)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     121452602 (Nfkbia)    04931 Insulin resistance     121452602 (Nfkbia)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:morg03000]     121452602 (Nfkbia)    04131 Membrane trafficking [BR:morg04131]     121452602 (Nfkbia) Transcription factors [BR:morg03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     121452602 (Nfkbia) Membrane trafficking [BR:morg04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     121452602 (Nfkbia) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank Ank_2 Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  121452602 NCBI-ProteinID:  XP_041514763 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFQPVGQGQDWAMEGPRDGLKKERLVDDRHDSGLDSMKDEEYEQMVKELREIRLQPQEAQ LAAEPWKQQLTEDGDSFLHLAIIHEEKTLTMEVIRQVKGDLAFLNFQNNLLQTPLHLAVI TNQPGIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGILTQTCTPQHLHSILQATN YNGHTCLHLASIHGYLGIVEHLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQTLPESEDEDCYDTESEFTEDEL PYDDCVFGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcagccggtcggccaaggccaggactgggccatggagggcccgcgggacggcctc aagaaagagcggctggtggacgatcgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaggagctgcgcgagatccgcctgcagccgcaggaggcgcag ctggccgccgagccctggaagcagcagctcacggaggacggagactcgttcctgcacttg gcaatcatccatgaagagaagactctgaccatggaagtgattcggcaggtgaagggagac ctcgccttcctcaacttccagaacaacctgctgcagactccacttcacttggctgtgatc accaaccagccaggaattgctgaggcacttttggaagctggctgtgatcctgagctccga gactttcgaggaaatacccctctacatcttgcctgtgagcagggctgcctggccagtgtg ggaatcctaacgcagacttgcacaccccagcatctccactccatcctgcaggccaccaac tacaacggccacacgtgtctgcacctagcctccatccacggctacctgggcatcgtggag catctggtgtctttgggtgcggatgtcaacgcgcaggagccctgcaatggccggacagcc ctccaccttgcggtggacctgcagaatcctgacctggtctcgctcttgctgaagtgtggc gctgatgtcaacagagtcacctaccaaggctactccccctatcagctcacctggggccgc ccgagcacccggatacagcagcagctgggccagctgaccctggaaaaccttcagacactg ccggagagcgaggatgaggattgctacgacacagagtccgagttcacggaggatgagctg ccctatgacgactgtgtgtttggaggccagcgtctgacgttgtga

DBGET integrated database retrieval system