Microtus oregoni (creeping vole): 121452714 Help Entry 121452714         CDS       T08307                                  Symbol Il2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism morg  Microtus oregoni (creeping vole) Pathway morg04060   Cytokine-cytokine receptor interaction morg04061   Viral protein interaction with cytokine and cytokine receptor morg04151   PI3K-Akt signaling pathway morg04625   C-type lectin receptor signaling pathway morg04630   JAK-STAT signaling pathway morg04658   Th1 and Th2 cell differentiation morg04659   Th17 cell differentiation morg04660   T cell receptor signaling pathway morg04672   Intestinal immune network for IgA production morg04940   Type I diabetes mellitus morg05135   Yersinia infection morg05142   Chagas disease morg05162   Measles morg05166   Human T-cell leukemia virus 1 infection morg05171   Coronavirus disease - COVID-19 morg05200   Pathways in cancer morg05320   Autoimmune thyroid disease morg05321   Inflammatory bowel disease morg05330   Allograft rejection morg05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     121452714 (Il2)    04151 PI3K-Akt signaling pathway     121452714 (Il2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121452714 (Il2)    04061 Viral protein interaction with cytokine and cytokine receptor     121452714 (Il2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121452714 (Il2)    04660 T cell receptor signaling pathway     121452714 (Il2)    04658 Th1 and Th2 cell differentiation     121452714 (Il2)    04659 Th17 cell differentiation     121452714 (Il2)    04672 Intestinal immune network for IgA production     121452714 (Il2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121452714 (Il2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121452714 (Il2)    05171 Coronavirus disease - COVID-19     121452714 (Il2)    05162 Measles     121452714 (Il2)   09171 Infectious disease: bacterial    05135 Yersinia infection     121452714 (Il2)   09174 Infectious disease: parasitic    05142 Chagas disease     121452714 (Il2)   09163 Immune disease    05320 Autoimmune thyroid disease     121452714 (Il2)    05321 Inflammatory bowel disease     121452714 (Il2)    05330 Allograft rejection     121452714 (Il2)    05332 Graft-versus-host disease     121452714 (Il2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     121452714 (Il2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121452714 (Il2)    00536 Glycosaminoglycan binding proteins [BR:morg00536]     121452714 (Il2) Cytokines and neuropeptides [BR:morg04052]  Cytokines   Interleukins    121452714 (Il2) Glycosaminoglycan binding proteins [BR:morg00536]  Heparan sulfate / Heparin   Cytokines    121452714 (Il2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 Desmo_N Portal_T4 Motif Other DBs NCBI-GeneID:  121452714 NCBI-ProteinID:  XP_041514855 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MYNMQLASCVVLTLVLLVNSAPTPSSTKETQQHLTQLLLDLQMLLRGINNDRNPKLPMML TFKFYMPKKATELKHLHCLEEELGALQSVLDLAQSKSFHLKDAENFISNIRVTVGKLKGS ENTSSCEFDDETVTVVEFLSRWIAFCQSIIATMTQ NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtacaacatgcagcttgcatcctgtgttgtactgacgctcgtgctcctcgtcaacagc gcacccactccaagctctacaaaggaaacacagcagcacctcacgcagttattgctggac ttacagatgcttctgagagggatcaataatgacaggaatccgaaactccccatgatgctc acgtttaaattttacatgcccaagaaggccacagaactaaaacatcttcactgcctagaa gaagagctcggggctctgcagagtgtgctggatttggctcagagcaaaagctttcacttg aaagatgctgagaatttcatcagcaacatcagagtaacagttgggaaactgaagggctct gagaacacatcctcgtgtgaattcgatgatgagacggtaactgtggtggaatttctgagc agatggattgccttctgtcaaagtatcatcgcaacaatgactcaataa

DBGET integrated database retrieval system