Microtus oregoni (creeping vole): 121452918 Help Entry 121452918         CDS       T08307                                  Symbol Pfn2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism morg  Microtus oregoni (creeping vole) Pathway morg04015   Rap1 signaling pathway morg04810   Regulation of actin cytoskeleton morg05014   Amyotrophic lateral sclerosis morg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     121452918 (Pfn2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     121452918 (Pfn2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121452918 (Pfn2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     121452918 (Pfn2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:morg04131]     121452918 (Pfn2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:morg04812]     121452918 (Pfn2)    04147 Exosome [BR:morg04147]     121452918 (Pfn2) Membrane trafficking [BR:morg04131]  Others   Actin-binding proteins    Others     121452918 (Pfn2) Cytoskeleton proteins [BR:morg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      121452918 (Pfn2) Exosome [BR:morg04147]  Exosomal proteins   Proteins found in most exosomes    121452918 (Pfn2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  121452918 NCBI-ProteinID:  XP_041515238 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcatcacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggtgcaaagaagtgttcagtgatcagagatagcctatacgtt gatggtgactgcacaatggatatccggacaaagagtcaaggtggggagccaacatacaat gttgctgttggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system