Microtus oregoni (creeping vole): 121454073 Help Entry 121454073         CDS       T08307                                  Symbol Cfl1 Name (RefSeq) cofilin-1   KO K05765   cofilin Organism morg  Microtus oregoni (creeping vole) Pathway morg04360   Axon guidance morg04666   Fc gamma R-mediated phagocytosis morg04810   Regulation of actin cytoskeleton morg05133   Pertussis morg05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:morg00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     121454073 (Cfl1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     121454073 (Cfl1)   09158 Development and regeneration    04360 Axon guidance     121454073 (Cfl1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     121454073 (Cfl1)   09171 Infectious disease: bacterial    05133 Pertussis     121454073 (Cfl1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:morg04131]     121454073 (Cfl1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:morg04812]     121454073 (Cfl1)    04147 Exosome [BR:morg04147]     121454073 (Cfl1) Membrane trafficking [BR:morg04131]  Others   Actin-binding proteins    Others     121454073 (Cfl1) Cytoskeleton proteins [BR:morg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      121454073 (Cfl1) Exosome [BR:morg04147]  Exosomal proteins   Proteins found in most exosomes    121454073 (Cfl1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  121454073 NCBI-ProteinID:  XP_041517214 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctctggtgtggctgtctctgatggtgtcatcaaggtgttcaatgacatgaaagtg cgcaagtcttcgacgccagaagaagtgaagaaacgcaagaaggcggtgcttttctgcctg agtgaggacaagaagaacatcatcctggaggagggcaaggagatcctggtaggagatgtg gggcagactgtggacgatccctacaccacctttgtcaagatgctgccagacaaggactgc cgctacgctctctatgatgccacctatgagaccaaggagagcaagaaggaggacctggtg ttcatcttctgggcccctgagagtgcaccccttaagagcaaaatgatctacgccagctcc aaggatgccatcaagaagaagctgacaggaatcaagcatgaattacaagcaaactgctac gaggaggtcaaggaccgctgcaccctggcagagaaactaggtggcagtgccgtcatctcc ctggagggcaagcctttgtga

DBGET integrated database retrieval system