Microtus oregoni (creeping vole): 121456365 Help Entry 121456365         CDS       T08307                                  Symbol Il13 Name (RefSeq) interleukin-13   KO K05435   interleukin 13 Organism morg  Microtus oregoni (creeping vole) Pathway morg04060   Cytokine-cytokine receptor interaction morg04630   JAK-STAT signaling pathway morg04657   IL-17 signaling pathway morg04658   Th1 and Th2 cell differentiation morg04664   Fc epsilon RI signaling pathway morg05200   Pathways in cancer morg05310   Asthma morg05321   Inflammatory bowel disease Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     121456365 (Il13)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121456365 (Il13)  09150 Organismal Systems   09151 Immune system    04658 Th1 and Th2 cell differentiation     121456365 (Il13)    04657 IL-17 signaling pathway     121456365 (Il13)    04664 Fc epsilon RI signaling pathway     121456365 (Il13)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121456365 (Il13)   09163 Immune disease    05310 Asthma     121456365 (Il13)    05321 Inflammatory bowel disease     121456365 (Il13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121456365 (Il13) Cytokines and neuropeptides [BR:morg04052]  Cytokines   Interleukins    121456365 (Il13) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL13 Motif Other DBs NCBI-GeneID:  121456365 NCBI-ProteinID:  XP_041520378 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MALWLTAVLALACLSGLAAPSPVQRSPAPSIVPLRELIEELINITQDQRAPLCNGSMVWS MDLRAGGFCAALDSLTNISSCKPIYKTQRILNGLCTRKASVGVSNLSDTKIELAQFITKL LTYSRLRYRHDNQS NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atggcgctctggttgacggcagtcctggctctcgcctgcctcagtggtctcgctgcccca agcccggtgcagcgatccccggctccttccattgtgcccctcagggagcttattgaggag ttgatcaacatcacacaagaccagagggctcccctgtgcaatggcagcatggtatggagc atggacctgagagctggcgggttctgtgcagccctggattccctgaccaacatctccagt tgcaaacccatctacaagacccagaggatactgaatggactctgtacccggaaggcctca gtgggggtttccaacctttcagacaccaaaatcgaactggcccagtttataacaaaactg cttacctactcaaggctacgttatcgccacgacaaccaatcctga

DBGET integrated database retrieval system