Microtus oregoni (creeping vole): 121456535 Help Entry 121456535         CDS       T08307                                  Symbol Pfn1 Name (RefSeq) profilin-1   KO K05759   profilin Organism morg  Microtus oregoni (creeping vole) Pathway morg04015   Rap1 signaling pathway morg04810   Regulation of actin cytoskeleton morg05014   Amyotrophic lateral sclerosis morg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     121456535 (Pfn1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     121456535 (Pfn1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121456535 (Pfn1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     121456535 (Pfn1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:morg04131]     121456535 (Pfn1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:morg04812]     121456535 (Pfn1)    04147 Exosome [BR:morg04147]     121456535 (Pfn1) Membrane trafficking [BR:morg04131]  Others   Actin-binding proteins    Others     121456535 (Pfn1) Cytoskeleton proteins [BR:morg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      121456535 (Pfn1) Exosome [BR:morg04147]  Exosomal proteins   Proteins found in most exosomes    121456535 (Pfn1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  121456535 NCBI-ProteinID:  XP_041520715 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDSLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVSITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVH GGLINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacagcctcatggcggacgggacctgtcaggacgcg gccatcgtaggctacaaggactcgccctccgtctgggccgccgtccccgggaagaccttc gttagcattacgccagctgaggttggtgtcctggtaggcaaagaccggtcaagttttttc gtgaatgggttgacacttgggggccagaaatgttctgtgatccgggactcactgctgcag gatggggaatttacaatggatcttcgtaccaagagcaccggaggagcccccaccttcaat gtcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtttgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system