Microtus oregoni (creeping vole): 121456763 Help Entry 121456763         CDS       T08307                                  Name (RefSeq) histone H2B type 3-B   KO K11252   histone H2B Organism morg  Microtus oregoni (creeping vole) Pathway morg04613   Neutrophil extracellular trap formation morg05034   Alcoholism morg05203   Viral carcinogenesis morg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:morg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     121456763  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     121456763   09163 Immune disease    05322 Systemic lupus erythematosus     121456763   09165 Substance dependence    05034 Alcoholism     121456763  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:morg03036]     121456763   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:morg04147]     121456763 Chromosome and associated proteins [BR:morg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     121456763 Exosome [BR:morg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121456763 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like ARM_TT21 LonB_AAA-LID CENP-T_C Motif Other DBs NCBI-GeneID:  121456763 NCBI-ProteinID:  XP_041521131 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPDPSKSTPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgatccgtccaagtccactccggcccccaaaaaggggtccaagaaagccgttacc aaggcgcagaaaaaggacggcaaaaaacgcaaacggggccgcaaggagagctactccatc tatgtgtacaaggtgctgaagcaggtgcaccccgacactggcatttcgtctaaggccatg ggcatcatgaactcgttcgtcaacgatattttcgagcgcatcgccagcgaggcctcccgc ctggcgcattacaacaagcgctcgaccatcacgtcccgcgaggtgcagacggccgtgcgt ctgctgctgcccggggaactggctaagcatgctgtgtccgagggcaccaaggctgtcacc aagtacacgagctccaagtga

DBGET integrated database retrieval system