Microtus oregoni (creeping vole): 121456902 Help Entry 121456902         CDS       T08307                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism morg  Microtus oregoni (creeping vole) Pathway morg04060   Cytokine-cytokine receptor interaction morg04061   Viral protein interaction with cytokine and cytokine receptor morg04062   Chemokine signaling pathway morg04620   Toll-like receptor signaling pathway morg05142   Chagas disease morg05163   Human cytomegalovirus infection morg05323   Rheumatoid arthritis morg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121456902    04061 Viral protein interaction with cytokine and cytokine receptor     121456902  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121456902    04062 Chemokine signaling pathway     121456902  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     121456902   09174 Infectious disease: parasitic    05142 Chagas disease     121456902   09163 Immune disease    05323 Rheumatoid arthritis     121456902   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121456902  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121456902    00536 Glycosaminoglycan binding proteins [BR:morg00536]     121456902 Cytokines and neuropeptides [BR:morg04052]  Cytokines   Chemokines    121456902 Glycosaminoglycan binding proteins [BR:morg00536]  Heparan sulfate / Heparin   Chemokines    121456902 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 USP8_interact Motif Other DBs NCBI-GeneID:  121456902 NCBI-ProteinID:  XP_041521364 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search MKVPTAALAVLLCTMALCDQVFSAPYGADTPTSCCFTYSRQINRRFIADYFETSSLCSQP GVIFLTKRNRQICADPKETWVQEYMTDLELNA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaggtccccacagctgcccttgctgtccttctctgcaccatggctctctgtgaccaa gtcttctcagctccatatggtgctgacaccccaacctcctgctgcttcacctacagcagg cagattaaccgcagattcattgctgactattttgagaccagcagcctttgctctcagcca ggcgtcattttcctaactaagagaaaccggcagatctgcgctgaccccaaagaaacctgg gtgcaagaatacatgactgacctggagctgaatgcctga

DBGET integrated database retrieval system