Microtus oregoni (creeping vole): 121457438 Help Entry 121457438         CDS       T08307                                  Symbol Nps Name (RefSeq) neuropeptide S   KO K25691   neuropeptide S Organism morg  Microtus oregoni (creeping vole) Pathway morg04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     121457438 (Nps)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121457438 (Nps) Cytokines and neuropeptides [BR:morg04052]  Neuropeptides   GPCR binding    121457438 (Nps) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Neuropeptide_S Motif Other DBs NCBI-GeneID:  121457438 NCBI-ProteinID:  XP_041522030 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MKLSLKFNLILVLSLSMAQVLWSYPVLSSKVPAKPDYFLILLSSCPTRMEESDGLAFLKS ILEKTSMKRSFRNGVGSGVKKTSFQRAKQ NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaaactctcgttgaaattcaacctcatcttggttttgtcgctgtccatggcacaggtg ttgtggagttatcctgtcctctcttccaaggtgcctgcgaaacctgattactttctcatc ctactgagcagctgcccaaccaggatggaggagagcgacgggctagctttcctaaagtca attttggagaagacatcgatgaaaaggtcctttcgcaacggagtcggctcgggggtgaaa aaaacttcatttcaaagagcaaagcaatga

DBGET integrated database retrieval system