Microtus oregoni (creeping vole): 121457996 Help Entry 121457996         CDS       T08307                                  Symbol Rras2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism morg  Microtus oregoni (creeping vole) Pathway morg04010   MAPK signaling pathway morg04014   Ras signaling pathway morg04024   cAMP signaling pathway morg04072   Phospholipase D signaling pathway morg04137   Mitophagy - animal morg04140   Autophagy - animal morg04218   Cellular senescence morg04371   Apelin signaling pathway morg04625   C-type lectin receptor signaling pathway morg04810   Regulation of actin cytoskeleton morg05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121457996 (Rras2)    04014 Ras signaling pathway     121457996 (Rras2)    04371 Apelin signaling pathway     121457996 (Rras2)    04072 Phospholipase D signaling pathway     121457996 (Rras2)    04024 cAMP signaling pathway     121457996 (Rras2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121457996 (Rras2)    04137 Mitophagy - animal     121457996 (Rras2)   09143 Cell growth and death    04218 Cellular senescence     121457996 (Rras2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     121457996 (Rras2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121457996 (Rras2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     121457996 (Rras2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:morg04147]     121457996 (Rras2)    04031 GTP-binding proteins [BR:morg04031]     121457996 (Rras2) Exosome [BR:morg04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    121457996 (Rras2)   Exosomal proteins of bladder cancer cells    121457996 (Rras2) GTP-binding proteins [BR:morg04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     121457996 (Rras2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 SLFN-g3_helicase Motif Other DBs NCBI-GeneID:  121457996 NCBI-ProteinID:  XP_041523040 LinkDB All DBs Position Unknown AA seq 204 aa AA seqDB search MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDR AARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEF PMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE QECPPSPEPTRKEKDKKGCHCVVS NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggccgcggccggctggcgcgacggctccggccaggagaagtaccggctcgtggtggtc ggcggcggcggcgtgggcaagtcggcgctcaccatccagttcatccagtcctattttgtg acggactatgacccgaccattgaagactcatacacaaagcagtgtgtcatcgatgaccga gcggcccggctggacattttggatacagccggacaagaggagtttggagccatgagagag cagtacatgaggaccggcgagggcttcctgctggtcttttcagtcacggataggggcagt tttgaagaaatctataagtttcaaagacagattctccgagtaaaggaccgtgatgagttc cccatgattttaattggcaacaaagctgacctggatcaccagagacaggtaacgcaggaa gaagggcagcagttagcgaggcagctcaaggtcacgtacatggaggcgtcggctaagatc aggatgaatgtagatcaagctttccatgaactcgtccgagttataaggaaatttcaagag caagaatgccctccgtcgccagaaccaacccggaaggaaaaagacaagaaaggctgtcat tgtgtcgtttcctaa

DBGET integrated database retrieval system