KEGG   Microtus oregoni (creeping vole): 121458143
Entry
121458143         CDS       T08307                                 
Symbol
Mapk3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
morg  Microtus oregoni (creeping vole)
Pathway
morg01521  EGFR tyrosine kinase inhibitor resistance
morg01522  Endocrine resistance
morg01524  Platinum drug resistance
morg04010  MAPK signaling pathway
morg04012  ErbB signaling pathway
morg04014  Ras signaling pathway
morg04015  Rap1 signaling pathway
morg04022  cGMP-PKG signaling pathway
morg04024  cAMP signaling pathway
morg04062  Chemokine signaling pathway
morg04066  HIF-1 signaling pathway
morg04068  FoxO signaling pathway
morg04071  Sphingolipid signaling pathway
morg04072  Phospholipase D signaling pathway
morg04114  Oocyte meiosis
morg04140  Autophagy - animal
morg04148  Efferocytosis
morg04150  mTOR signaling pathway
morg04151  PI3K-Akt signaling pathway
morg04210  Apoptosis
morg04218  Cellular senescence
morg04261  Adrenergic signaling in cardiomyocytes
morg04270  Vascular smooth muscle contraction
morg04350  TGF-beta signaling pathway
morg04360  Axon guidance
morg04370  VEGF signaling pathway
morg04371  Apelin signaling pathway
morg04380  Osteoclast differentiation
morg04510  Focal adhesion
morg04520  Adherens junction
morg04540  Gap junction
morg04550  Signaling pathways regulating pluripotency of stem cells
morg04611  Platelet activation
morg04613  Neutrophil extracellular trap formation
morg04620  Toll-like receptor signaling pathway
morg04621  NOD-like receptor signaling pathway
morg04625  C-type lectin receptor signaling pathway
morg04650  Natural killer cell mediated cytotoxicity
morg04657  IL-17 signaling pathway
morg04658  Th1 and Th2 cell differentiation
morg04659  Th17 cell differentiation
morg04660  T cell receptor signaling pathway
morg04662  B cell receptor signaling pathway
morg04664  Fc epsilon RI signaling pathway
morg04666  Fc gamma R-mediated phagocytosis
morg04668  TNF signaling pathway
morg04713  Circadian entrainment
morg04720  Long-term potentiation
morg04722  Neurotrophin signaling pathway
morg04723  Retrograde endocannabinoid signaling
morg04724  Glutamatergic synapse
morg04725  Cholinergic synapse
morg04726  Serotonergic synapse
morg04730  Long-term depression
morg04810  Regulation of actin cytoskeleton
morg04910  Insulin signaling pathway
morg04912  GnRH signaling pathway
morg04914  Progesterone-mediated oocyte maturation
morg04915  Estrogen signaling pathway
morg04916  Melanogenesis
morg04917  Prolactin signaling pathway
morg04919  Thyroid hormone signaling pathway
morg04921  Oxytocin signaling pathway
morg04926  Relaxin signaling pathway
morg04928  Parathyroid hormone synthesis, secretion and action
morg04929  GnRH secretion
morg04930  Type II diabetes mellitus
morg04933  AGE-RAGE signaling pathway in diabetic complications
morg04934  Cushing syndrome
morg04935  Growth hormone synthesis, secretion and action
morg04960  Aldosterone-regulated sodium reabsorption
morg05010  Alzheimer disease
morg05020  Prion disease
morg05022  Pathways of neurodegeneration - multiple diseases
morg05034  Alcoholism
morg05132  Salmonella infection
morg05133  Pertussis
morg05135  Yersinia infection
morg05140  Leishmaniasis
morg05142  Chagas disease
morg05145  Toxoplasmosis
morg05152  Tuberculosis
morg05160  Hepatitis C
morg05161  Hepatitis B
morg05163  Human cytomegalovirus infection
morg05164  Influenza A
morg05165  Human papillomavirus infection
morg05166  Human T-cell leukemia virus 1 infection
morg05167  Kaposi sarcoma-associated herpesvirus infection
morg05170  Human immunodeficiency virus 1 infection
morg05171  Coronavirus disease - COVID-19
morg05200  Pathways in cancer
morg05203  Viral carcinogenesis
morg05205  Proteoglycans in cancer
morg05206  MicroRNAs in cancer
morg05207  Chemical carcinogenesis - receptor activation
morg05208  Chemical carcinogenesis - reactive oxygen species
morg05210  Colorectal cancer
morg05211  Renal cell carcinoma
morg05212  Pancreatic cancer
morg05213  Endometrial cancer
morg05214  Glioma
morg05215  Prostate cancer
morg05216  Thyroid cancer
morg05218  Melanoma
morg05219  Bladder cancer
morg05220  Chronic myeloid leukemia
morg05221  Acute myeloid leukemia
morg05223  Non-small cell lung cancer
morg05224  Breast cancer
morg05225  Hepatocellular carcinoma
morg05226  Gastric cancer
morg05230  Central carbon metabolism in cancer
morg05231  Choline metabolism in cancer
morg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
morg05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:morg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    121458143 (Mapk3)
   04015 Rap1 signaling pathway
    121458143 (Mapk3)
   04350 TGF-beta signaling pathway
    121458143 (Mapk3)
   04668 TNF signaling pathway
    121458143 (Mapk3)
   04066 HIF-1 signaling pathway
    121458143 (Mapk3)
   04068 FoxO signaling pathway
    121458143 (Mapk3)
   04072 Phospholipase D signaling pathway
    121458143 (Mapk3)
   04071 Sphingolipid signaling pathway
    121458143 (Mapk3)
   04024 cAMP signaling pathway
    121458143 (Mapk3)
   04022 cGMP-PKG signaling pathway
    121458143 (Mapk3)
   04151 PI3K-Akt signaling pathway
    121458143 (Mapk3)
   04150 mTOR signaling pathway
    121458143 (Mapk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    121458143 (Mapk3)
   04148 Efferocytosis
    121458143 (Mapk3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    121458143 (Mapk3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    121458143 (Mapk3)
   04613 Neutrophil extracellular trap formation
    121458143 (Mapk3)
   04620 Toll-like receptor signaling pathway
    121458143 (Mapk3)
   04650 Natural killer cell mediated cytotoxicity
    121458143 (Mapk3)
   04660 T cell receptor signaling pathway
    121458143 (Mapk3)
   04658 Th1 and Th2 cell differentiation
    121458143 (Mapk3)
   04659 Th17 cell differentiation
    121458143 (Mapk3)
   04657 IL-17 signaling pathway
    121458143 (Mapk3)
   04662 B cell receptor signaling pathway
    121458143 (Mapk3)
   04664 Fc epsilon RI signaling pathway
    121458143 (Mapk3)
   04666 Fc gamma R-mediated phagocytosis
    121458143 (Mapk3)
   04062 Chemokine signaling pathway
    121458143 (Mapk3)
  09152 Endocrine system
   04929 GnRH secretion
    121458143 (Mapk3)
   04915 Estrogen signaling pathway
    121458143 (Mapk3)
   04917 Prolactin signaling pathway
    121458143 (Mapk3)
   04921 Oxytocin signaling pathway
    121458143 (Mapk3)
   04926 Relaxin signaling pathway
    121458143 (Mapk3)
   04935 Growth hormone synthesis, secretion and action
    121458143 (Mapk3)
   04919 Thyroid hormone signaling pathway
    121458143 (Mapk3)
   04928 Parathyroid hormone synthesis, secretion and action
    121458143 (Mapk3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    121458143 (Mapk3)
  09156 Nervous system
   04724 Glutamatergic synapse
    121458143 (Mapk3)
   04725 Cholinergic synapse
    121458143 (Mapk3)
   04726 Serotonergic synapse
    121458143 (Mapk3)
   04720 Long-term potentiation
    121458143 (Mapk3)
   04730 Long-term depression
    121458143 (Mapk3)
   04723 Retrograde endocannabinoid signaling
    121458143 (Mapk3)
   04722 Neurotrophin signaling pathway
    121458143 (Mapk3)
  09158 Development and regeneration
   04360 Axon guidance
    121458143 (Mapk3)
   04380 Osteoclast differentiation
    121458143 (Mapk3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    121458143 (Mapk3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    121458143 (Mapk3)
   05206 MicroRNAs in cancer
    121458143 (Mapk3)
   05205 Proteoglycans in cancer
    121458143 (Mapk3)
   05207 Chemical carcinogenesis - receptor activation
    121458143 (Mapk3)
   05208 Chemical carcinogenesis - reactive oxygen species
    121458143 (Mapk3)
   05203 Viral carcinogenesis
    121458143 (Mapk3)
   05230 Central carbon metabolism in cancer
    121458143 (Mapk3)
   05231 Choline metabolism in cancer
    121458143 (Mapk3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    121458143 (Mapk3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    121458143 (Mapk3)
   05212 Pancreatic cancer
    121458143 (Mapk3)
   05225 Hepatocellular carcinoma
    121458143 (Mapk3)
   05226 Gastric cancer
    121458143 (Mapk3)
   05214 Glioma
    121458143 (Mapk3)
   05216 Thyroid cancer
    121458143 (Mapk3)
   05221 Acute myeloid leukemia
    121458143 (Mapk3)
   05220 Chronic myeloid leukemia
    121458143 (Mapk3)
   05218 Melanoma
    121458143 (Mapk3)
   05211 Renal cell carcinoma
    121458143 (Mapk3)
   05219 Bladder cancer
    121458143 (Mapk3)
   05215 Prostate cancer
    121458143 (Mapk3)
   05213 Endometrial cancer
    121458143 (Mapk3)
   05224 Breast cancer
    121458143 (Mapk3)
   05223 Non-small cell lung cancer
    121458143 (Mapk3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    121458143 (Mapk3)
   05170 Human immunodeficiency virus 1 infection
    121458143 (Mapk3)
   05161 Hepatitis B
    121458143 (Mapk3)
   05160 Hepatitis C
    121458143 (Mapk3)
   05171 Coronavirus disease - COVID-19
    121458143 (Mapk3)
   05164 Influenza A
    121458143 (Mapk3)
   05163 Human cytomegalovirus infection
    121458143 (Mapk3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    121458143 (Mapk3)
   05165 Human papillomavirus infection
    121458143 (Mapk3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    121458143 (Mapk3)
   05133 Pertussis
    121458143 (Mapk3)
   05152 Tuberculosis
    121458143 (Mapk3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    121458143 (Mapk3)
   05140 Leishmaniasis
    121458143 (Mapk3)
   05142 Chagas disease
    121458143 (Mapk3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    121458143 (Mapk3)
   05020 Prion disease
    121458143 (Mapk3)
   05022 Pathways of neurodegeneration - multiple diseases
    121458143 (Mapk3)
  09165 Substance dependence
   05034 Alcoholism
    121458143 (Mapk3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    121458143 (Mapk3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    121458143 (Mapk3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    121458143 (Mapk3)
   04934 Cushing syndrome
    121458143 (Mapk3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    121458143 (Mapk3)
   01524 Platinum drug resistance
    121458143 (Mapk3)
   01522 Endocrine resistance
    121458143 (Mapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:morg01001]
    121458143 (Mapk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:morg03036]
    121458143 (Mapk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:morg04147]
    121458143 (Mapk3)
Enzymes [BR:morg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     121458143 (Mapk3)
Protein kinases [BR:morg01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   121458143 (Mapk3)
Chromosome and associated proteins [BR:morg03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     121458143 (Mapk3)
Exosome [BR:morg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   121458143 (Mapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 121458143
NCBI-ProteinID: XP_041523214
LinkDB
Position
Unknown
AA seq 378 aa
MAAAAPGGGGGEPRGAAGVGPGVPGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYD
HVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIV
QDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLK
ICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSN
RPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDS
KALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLK
ELIFQETARFQPGASEAP
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggcggcggcggctccggggggcgggggcggggagccccggggagccgctggggtcggc
ccgggggtcccgggggaggtggaggtggtgaagggacagccattcgacgtgggcccacgc
tacacgcagctgcaatacatcggcgagggcgcgtacggcatggtcagctctgcttatgac
cacgtgcgcaagactcgagtggccatcaagaagatcagccccttcgagcaccagacctac
tgccagcgtacactgagggagatccagatcttgctgcgattccgccatgagaatgtcata
ggcatccgagacatcctcagagcacccaccctggaagctatgagggatgtctacattgtt
caggacctcatggagacagacctgtacaagctgctaaagagccagcagctgagcaacgac
cacatctgctacttcctctaccagatccttcggggcctcaagtatatccattcagctaac
gtgctccaccgggatctgaagccctccaacctgcttatcaacaccacctgcgaccttaag
atctgtgattttggcctggcccggatcgctgaccctgaacatgaccacaccggcttcctg
acggagtatgtggccacacgctggtaccgagccccagagatcatgcttaactccaagggc
tacaccaaatccattgacatctggtctgtgggctgcattctggctgagatgctctccaac
cggcccatcttccctggcaagcactacctggaccagctcaaccacattctaggtatcttg
ggctccccatcccaggaggaccttaattgtatcatcaacatgaaggcccgaaattatcta
cagtctctgccctcgaaaactaaggtggcttgggccaagcttttccccaaatctgactcc
aaagcacttgacctgctggaccggatgttaaccttcaaccccaacaagcgcatcactgta
gaggaagcgctggctcacccgtacctggaacagtactatgacccaacagatgagccagtg
gctgaggagcccttcacctttgacatggagctggatgatctccccaaggagcggctgaag
gaactgatcttccaagaaacagcccgcttccagccaggggcctcagaggccccctaa

DBGET integrated database retrieval system