Microtus oregoni (creeping vole): 121458200 Help Entry 121458200         CDS       T08307                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism morg  Microtus oregoni (creeping vole) Pathway morg04621   NOD-like receptor signaling pathway morg05012   Parkinson disease morg05132   Salmonella infection morg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:morg00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     121458200  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121458200   09164 Neurodegenerative disease    05012 Parkinson disease     121458200   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     121458200  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:morg03110]     121458200 Chaperones and folding catalysts [BR:morg03110]  Protein folding catalysts   Protein disulfide isomerase    121458200 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 OST3_OST6 DIM1 AhpC-TSA Thioredoxin_7 Thioredoxin_9 Glutaredoxin Redoxin NODP Motif Other DBs NCBI-GeneID:  121458200 NCBI-ProteinID:  XP_041523241 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKLIKSKEAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSSVVFLEIDVD DCQDVAAECEVKCMPTFQFYKKGKKVGEFSGANKEKLESSITEFA NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagctgatcaagagcaaggaagcttttcaggaggccctggatgccgcgggagac aagctcgtggttgtggacttctcggccacgtggtgtggaccttgtaaaatgatcaagcct ttctttcattccctctctgaaaagtattccagtgtggtgttccttgaaatagatgtggat gactgccaggacgttgctgcagagtgtgaagtcaaatgcatgccgaccttccagttttac aaaaagggtaaaaaggtgggtgaattctctggtgcaaacaaggaaaagcttgaatcctct attactgaatttgcgtaa

DBGET integrated database retrieval system