Microtus oregoni (creeping vole): 121458563 Help Entry 121458563         CDS       T08307                                  Symbol Ccl19 Name (RefSeq) C-C motif chemokine 19   KO K05512   C-C motif chemokine 19 Organism morg  Microtus oregoni (creeping vole) Pathway morg04060   Cytokine-cytokine receptor interaction morg04061   Viral protein interaction with cytokine and cytokine receptor morg04062   Chemokine signaling pathway morg04064   NF-kappa B signaling pathway Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     121458563 (Ccl19)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121458563 (Ccl19)    04061 Viral protein interaction with cytokine and cytokine receptor     121458563 (Ccl19)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     121458563 (Ccl19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121458563 (Ccl19) Cytokines and neuropeptides [BR:morg04052]  Cytokines   Chemokines    121458563 (Ccl19) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Meg Motif Other DBs NCBI-GeneID:  121458563 NCBI-ProteinID:  XP_041523837 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MAPRVAPLLVFSLLVLGTFPAPALGGANDAEDCCLSVTQRPIPGNVVKAFRYLLMKDGCR VPAVVFTTLRGYQLCAPPDQPWVERIIRRLKKSKSKHSSS NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggcaccccgtgtggccccactgctggtcttcagcctgttggttctcgggaccttccca gccccagctcttgggggtgctaacgatgcggaagactgctgtctgtcggtgacccagcgc cccatccctgggaacgtcgtgaaagccttccgctaccttcttatgaaggatggctgcagg gtgcctgctgttgtgttcaccacactgaggggctaccaactctgcgcacccccagaccag ccttgggtggaacgcatcatccgaagactgaagaagtctaagagcaaacacagcagcagt taa

DBGET integrated database retrieval system