Microtus oregoni (creeping vole): 121459245 Help Entry 121459245         CDS       T08307                                  Symbol Rab1a Name (RefSeq) ras-related protein Rab-1A   KO K07874   Ras-related protein Rab-1A Organism morg  Microtus oregoni (creeping vole) Pathway morg04140   Autophagy - animal morg05014   Amyotrophic lateral sclerosis morg05022   Pathways of neurodegeneration - multiple diseases morg05134   Legionellosis Brite KEGG Orthology (KO) [BR:morg00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121459245 (Rab1a)  09160 Human Diseases   09171 Infectious disease: bacterial    05134 Legionellosis     121459245 (Rab1a)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     121459245 (Rab1a)    05022 Pathways of neurodegeneration - multiple diseases     121459245 (Rab1a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:morg04131]     121459245 (Rab1a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:morg04147]     121459245 (Rab1a)    04031 GTP-binding proteins [BR:morg04031]     121459245 (Rab1a) Membrane trafficking [BR:morg04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab GTPases     121459245 (Rab1a)  Autophagy   Other autophagy associated proteins     121459245 (Rab1a) Exosome [BR:morg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121459245 (Rab1a)   Exosomal proteins of other body fluids (saliva and urine)    121459245 (Rab1a)   Exosomal proteins of colorectal cancer cells    121459245 (Rab1a) GTP-binding proteins [BR:morg04031]  Small (monomeric) G-proteins   Rab Family    Rab1/35 [OT]     121459245 (Rab1a) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 Gtr1_RagA SRPRB FeoB_N AAA ABC_tran AAA_7 AAA_29 LANC_like AAA_16 AAA_22 Septin AAA_5 Dioxygenase_N CRAL_TRIO_2 TniB Motif Other DBs NCBI-GeneID:  121459245 NCBI-ProteinID:  XP_041524718 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGA TAGGAEKSNVKIQSTPVKQSGGGCC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtccagcatgaatcccgaatatgattatttattcaagttacttctgattggcgattct ggagttggaaagtcttgcctcctccttaggtttgcagatgatacatacacggaaagctat atcagcacaattggtgtggatttcaagatacgaactatagagttagacgggaaaacaatc aaacttcagatatgggacacagcaggccaggaacgatttagaacaatcacctccagttac tacagaggagcccatggcatcatagttgtgtatgatgtgacagatcaggagtccttcaat aatgttaaacagtggctgcaggagatagatcgctatgccagtgaaaatgtcaacaagttg ttggtagggaacaagtgtgacctgaccacaaagaaagtagtagactacacaacagcaaag gaatttgccgattcccttggaattccatttttggaaaccagtgctaagaatgcaacgaat gtagaacagtctttcatgacgatggcagctgagattaaaaagcgaatgggtcctggagca acagctggtggtgcagagaagtccaatgttaaaatccagagcactccagtcaagcagtca ggtggaggttgctgctaa

DBGET integrated database retrieval system