Microtus oregoni (creeping vole): 121459837 Help Entry 121459837         CDS       T08307                                  Name (RefSeq) cofilin-1-like   KO K05765   cofilin Organism morg  Microtus oregoni (creeping vole) Pathway morg04360   Axon guidance morg04666   Fc gamma R-mediated phagocytosis morg04810   Regulation of actin cytoskeleton morg05133   Pertussis morg05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:morg00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     121459837  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     121459837   09158 Development and regeneration    04360 Axon guidance     121459837  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     121459837   09171 Infectious disease: bacterial    05133 Pertussis     121459837  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:morg04131]     121459837   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:morg04812]     121459837    04147 Exosome [BR:morg04147]     121459837 Membrane trafficking [BR:morg04131]  Others   Actin-binding proteins    Others     121459837 Cytoskeleton proteins [BR:morg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      121459837 Exosome [BR:morg04147]  Exosomal proteins   Proteins found in most exosomes    121459837 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  121459837 NCBI-ProteinID:  XP_041525800 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNGMKVHKSSTPEEVKKRKNAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDVIKKKLTGIKHELQANCYEEVKDCCTLSEKLDGSAIISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctctggtgtggctgtctctgatggtgtcatcaaggtgttcaatggcatgaaagtg cacaagtcttccacgccagaagaagtgaagaaacgcaagaatgcagtgcttttctgcctg agtgaggacaagaagaacatcatcttggaggagggcaaggagatcctggtaggagatgtg gggcagactgtggacgatccctacaccacctttgtcaagatgctgccagacaaggactgc cgctacgctctctacgatgccacctatgagaccaaggagagcaagaaggaggacctggtg ttcatcttctgggccccggagagtgcaccccttaagagcaaaatgatctacgccagctcc aaggatgtcatcaagaagaagctgacaggaatcaagcatgaattacaagcaaactgctac gaggaggtcaaggactgctgcaccctgtcagagaaactagatggcagtgccatcatctcc ctggagggcaagcctttgtga

DBGET integrated database retrieval system