Microtus oregoni (creeping vole): 121460006 Help Entry 121460006         CDS       T08307                                  Symbol Ghrh Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism morg  Microtus oregoni (creeping vole) Pathway morg04080   Neuroactive ligand-receptor interaction morg04081   Hormone signaling morg04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     121460006 (Ghrh)    04081 Hormone signaling     121460006 (Ghrh)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     121460006 (Ghrh)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121460006 (Ghrh) Cytokines and neuropeptides [BR:morg04052]  Neuropeptides   GPCR binding    121460006 (Ghrh) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  121460006 NCBI-ProteinID:  XP_041526033 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MPLWVFFVILTLTSGSHCSLPTSLPFRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQ QGERNQEGTRIRPGRQVDSMWVDHRQVALESLLVALLQKHSRNSQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgccactctgggtgttctttgtgatcctcaccctcaccagtggctcccactgctcactg cccacctcactgcccttcaggatgaggcgatatgcagacgccatcttcaccaacagctac aggaaagttctgggccagctgtctgcccgcaaactgctccaggacatcatgagcaggcag cagggggagaggaaccaggaaggaaccagaatacggcctggccggcaggtggacagcatg tgggtggaccacaggcaggtggcgctggagagcctcttggtagccctgttgcagaagcac agcaggaattcccaaggatga

DBGET integrated database retrieval system