Microtus oregoni (creeping vole): 121460139 Help Entry 121460139         CDS       T08307                                  Symbol Bcl2l1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism morg  Microtus oregoni (creeping vole) Pathway morg01521   EGFR tyrosine kinase inhibitor resistance morg01524   Platinum drug resistance morg04014   Ras signaling pathway morg04064   NF-kappa B signaling pathway morg04115   p53 signaling pathway morg04137   Mitophagy - animal morg04140   Autophagy - animal morg04151   PI3K-Akt signaling pathway morg04210   Apoptosis morg04215   Apoptosis - multiple species morg04621   NOD-like receptor signaling pathway morg04630   JAK-STAT signaling pathway morg05012   Parkinson disease morg05014   Amyotrophic lateral sclerosis morg05022   Pathways of neurodegeneration - multiple diseases morg05145   Toxoplasmosis morg05162   Measles morg05166   Human T-cell leukemia virus 1 infection morg05168   Herpes simplex virus 1 infection morg05170   Human immunodeficiency virus 1 infection morg05200   Pathways in cancer morg05202   Transcriptional misregulation in cancer morg05212   Pancreatic cancer morg05220   Chronic myeloid leukemia morg05222   Small cell lung cancer morg05225   Hepatocellular carcinoma morg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     121460139 (Bcl2l1)    04630 JAK-STAT signaling pathway     121460139 (Bcl2l1)    04064 NF-kappa B signaling pathway     121460139 (Bcl2l1)    04151 PI3K-Akt signaling pathway     121460139 (Bcl2l1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121460139 (Bcl2l1)    04137 Mitophagy - animal     121460139 (Bcl2l1)   09143 Cell growth and death    04210 Apoptosis     121460139 (Bcl2l1)    04215 Apoptosis - multiple species     121460139 (Bcl2l1)    04115 p53 signaling pathway     121460139 (Bcl2l1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     121460139 (Bcl2l1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121460139 (Bcl2l1)    05202 Transcriptional misregulation in cancer     121460139 (Bcl2l1)   09162 Cancer: specific types    05212 Pancreatic cancer     121460139 (Bcl2l1)    05225 Hepatocellular carcinoma     121460139 (Bcl2l1)    05220 Chronic myeloid leukemia     121460139 (Bcl2l1)    05222 Small cell lung cancer     121460139 (Bcl2l1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121460139 (Bcl2l1)    05170 Human immunodeficiency virus 1 infection     121460139 (Bcl2l1)    05162 Measles     121460139 (Bcl2l1)    05168 Herpes simplex virus 1 infection     121460139 (Bcl2l1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     121460139 (Bcl2l1)   09164 Neurodegenerative disease    05012 Parkinson disease     121460139 (Bcl2l1)    05014 Amyotrophic lateral sclerosis     121460139 (Bcl2l1)    05022 Pathways of neurodegeneration - multiple diseases     121460139 (Bcl2l1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121460139 (Bcl2l1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     121460139 (Bcl2l1)    01524 Platinum drug resistance     121460139 (Bcl2l1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:morg01009]     121460139 (Bcl2l1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:morg03036]     121460139 (Bcl2l1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:morg02000]     121460139 (Bcl2l1) Protein phosphatases and associated proteins [BR:morg01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      121460139 (Bcl2l1) Chromosome and associated proteins [BR:morg03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     121460139 (Bcl2l1) Transporters [BR:morg02000]  Other transporters   Pores ion channels [TC:1]    121460139 (Bcl2l1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  121460139 NCBI-ProteinID:  XP_041526260 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGPESERETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP WIQDNGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaag ggatacagctggagtcagtttagtgatgtcgaagagaacaggactgaggccccagaagga cctgaatcagagagggagacccccagtgccatcaatggcaacccatcctggcacctggcg gatagccccgcggtaaatggagccactggccacagcagcagtttggatgcccgggaggtg atccccatggcagcagtgaagcaagcgctgagagaggctggcgatgagtttgaactgcgg taccggcgggcgttcagtgatctaacatcgcagcttcacataaccccagggacagcatat caaagctttgagcaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatc gtggcctttttctccttcggtggagccctgtgtgtggaaagcgtagacaaggagatgcag gtattggtgagtcggattgcaagttggatggccacctatctgaatgaccacctagagcct tggatccaggacaacggcggctgggacacttttgtggaactctacgggaacaacgcagca gctgagagccggaaaggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggtgtggttctactgggctcgctcttcagtcggaagtga

DBGET integrated database retrieval system