Microtus oregoni (creeping vole): 121460451 Help Entry 121460451         CDS       T08307                                  Symbol Il1a Name (RefSeq) interleukin-1 alpha   KO K04383   interleukin 1 alpha Organism morg  Microtus oregoni (creeping vole) Pathway morg04010   MAPK signaling pathway morg04060   Cytokine-cytokine receptor interaction morg04217   Necroptosis morg04218   Cellular senescence morg04380   Osteoclast differentiation morg04640   Hematopoietic cell lineage morg04932   Non-alcoholic fatty liver disease morg04933   AGE-RAGE signaling pathway in diabetic complications morg04940   Type I diabetes mellitus morg05010   Alzheimer disease morg05020   Prion disease morg05022   Pathways of neurodegeneration - multiple diseases morg05133   Pertussis morg05140   Leishmaniasis morg05152   Tuberculosis morg05162   Measles morg05164   Influenza A morg05321   Inflammatory bowel disease morg05323   Rheumatoid arthritis morg05332   Graft-versus-host disease morg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121460451 (Il1a)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121460451 (Il1a)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     121460451 (Il1a)    04218 Cellular senescence     121460451 (Il1a)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     121460451 (Il1a)   09158 Development and regeneration    04380 Osteoclast differentiation     121460451 (Il1a)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     121460451 (Il1a)    05162 Measles     121460451 (Il1a)   09171 Infectious disease: bacterial    05133 Pertussis     121460451 (Il1a)    05152 Tuberculosis     121460451 (Il1a)   09174 Infectious disease: parasitic    05140 Leishmaniasis     121460451 (Il1a)   09163 Immune disease    05323 Rheumatoid arthritis     121460451 (Il1a)    05321 Inflammatory bowel disease     121460451 (Il1a)    05332 Graft-versus-host disease     121460451 (Il1a)   09164 Neurodegenerative disease    05010 Alzheimer disease     121460451 (Il1a)    05020 Prion disease     121460451 (Il1a)    05022 Pathways of neurodegeneration - multiple diseases     121460451 (Il1a)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     121460451 (Il1a)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     121460451 (Il1a)    04932 Non-alcoholic fatty liver disease     121460451 (Il1a)    04933 AGE-RAGE signaling pathway in diabetic complications     121460451 (Il1a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121460451 (Il1a) Cytokines and neuropeptides [BR:morg04052]  Cytokines   Interleukins    121460451 (Il1a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep DUF5645 Motif Other DBs NCBI-GeneID:  121460451 NCBI-ProteinID:  XP_041526792 LinkDB All DBs Position Unknown AA seq 268 aa AA seqDB search MAKVPDLFEDLKNCYSENEEYNSAIDHLSLNQKSFYEASYGSLHEKCTDKFVSLRASETS KMSNFTFEESLVMVAATSDQGKVLKKRRLGFDQIFAEDDLEAMTHNLEETIQSDSAPHVF QNNVIYKRSRLIKSNFVMNDSLNQNLCLDVDKVHLRAVPLTDLQHEVKFDMYAYSSDDSK FPVTLKLSNTQLFVSAQGEDEPVLLKELPETPKVITGSEVDLVFFWEQINTKNYFTSAAY PELFIATKEQSRVHLAKGLPSMTDFQIS NT seq 807 nt NT seq  +upstreamnt  +downstreamnt atggccaaagttcctgatttgtttgaagacctgaagaactgttacagtgaaaatgaagaa tacaattctgccattgaccacctctctctgaatcagaaatccttctatgaggcaagctat ggctcacttcatgagaaatgcacggacaaatttgtgtctctgagagcttccgaaacctca aagatgtccaacttcaccttcgaggagagcctggtgatggtggcagcgacatcagaccaa gggaaggttttgaagaagaggcggctgggtttcgatcagatctttgctgaagatgacctg gaggccatgacccataatttagaagagaccatccaatcggattcagcacctcacgtcttc caaaataatgtgatatacaaacggtcaaggcttatcaagtcaaatttcgtcatgaatgat tccctcaatcaaaacctatgcctggatgtggacaaggtgcatctcagagctgtcccacta actgacctgcaacatgaagtaaaatttgacatgtatgcctactcatcggacgactctaaa tttcctgttactctgaaactctcaaacacccagctgtttgtgagtgcccaaggtgaagac gagcctgtgctgctgaaggagctgcctgaaacaccgaaagtcatcacggggagtgaggtc gacctcgttttcttctgggaacagatcaacactaagaactacttcacatcagctgcttac ccagagctgtttatcgccaccaaagaacagagccgggtgcacctggccaaggggctgccc tccatgacagacttccagatctcgtaa

DBGET integrated database retrieval system