Microtus oregoni (creeping vole): 121460531 Help Entry 121460531         CDS       T08307                                  Symbol Il1b Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism morg  Microtus oregoni (creeping vole) Pathway morg01523   Antifolate resistance morg04010   MAPK signaling pathway morg04060   Cytokine-cytokine receptor interaction morg04064   NF-kappa B signaling pathway morg04217   Necroptosis morg04380   Osteoclast differentiation morg04620   Toll-like receptor signaling pathway morg04621   NOD-like receptor signaling pathway morg04623   Cytosolic DNA-sensing pathway morg04625   C-type lectin receptor signaling pathway morg04640   Hematopoietic cell lineage morg04657   IL-17 signaling pathway morg04659   Th17 cell differentiation morg04668   TNF signaling pathway morg04750   Inflammatory mediator regulation of TRP channels morg04932   Non-alcoholic fatty liver disease morg04933   AGE-RAGE signaling pathway in diabetic complications morg04936   Alcoholic liver disease morg04940   Type I diabetes mellitus morg05010   Alzheimer disease morg05020   Prion disease morg05022   Pathways of neurodegeneration - multiple diseases morg05132   Salmonella infection morg05133   Pertussis morg05134   Legionellosis morg05135   Yersinia infection morg05140   Leishmaniasis morg05142   Chagas disease morg05143   African trypanosomiasis morg05144   Malaria morg05146   Amoebiasis morg05152   Tuberculosis morg05162   Measles morg05163   Human cytomegalovirus infection morg05164   Influenza A morg05168   Herpes simplex virus 1 infection morg05171   Coronavirus disease - COVID-19 morg05321   Inflammatory bowel disease morg05323   Rheumatoid arthritis morg05332   Graft-versus-host disease morg05417   Lipid and atherosclerosis morg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121460531 (Il1b)    04064 NF-kappa B signaling pathway     121460531 (Il1b)    04668 TNF signaling pathway     121460531 (Il1b)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121460531 (Il1b)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     121460531 (Il1b)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     121460531 (Il1b)    04620 Toll-like receptor signaling pathway     121460531 (Il1b)    04621 NOD-like receptor signaling pathway     121460531 (Il1b)    04623 Cytosolic DNA-sensing pathway     121460531 (Il1b)    04625 C-type lectin receptor signaling pathway     121460531 (Il1b)    04659 Th17 cell differentiation     121460531 (Il1b)    04657 IL-17 signaling pathway     121460531 (Il1b)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     121460531 (Il1b)   09158 Development and regeneration    04380 Osteoclast differentiation     121460531 (Il1b)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     121460531 (Il1b)    05164 Influenza A     121460531 (Il1b)    05162 Measles     121460531 (Il1b)    05168 Herpes simplex virus 1 infection     121460531 (Il1b)    05163 Human cytomegalovirus infection     121460531 (Il1b)   09171 Infectious disease: bacterial    05132 Salmonella infection     121460531 (Il1b)    05135 Yersinia infection     121460531 (Il1b)    05133 Pertussis     121460531 (Il1b)    05134 Legionellosis     121460531 (Il1b)    05152 Tuberculosis     121460531 (Il1b)   09174 Infectious disease: parasitic    05146 Amoebiasis     121460531 (Il1b)    05144 Malaria     121460531 (Il1b)    05140 Leishmaniasis     121460531 (Il1b)    05142 Chagas disease     121460531 (Il1b)    05143 African trypanosomiasis     121460531 (Il1b)   09163 Immune disease    05323 Rheumatoid arthritis     121460531 (Il1b)    05321 Inflammatory bowel disease     121460531 (Il1b)    05332 Graft-versus-host disease     121460531 (Il1b)   09164 Neurodegenerative disease    05010 Alzheimer disease     121460531 (Il1b)    05020 Prion disease     121460531 (Il1b)    05022 Pathways of neurodegeneration - multiple diseases     121460531 (Il1b)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121460531 (Il1b)    05418 Fluid shear stress and atherosclerosis     121460531 (Il1b)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     121460531 (Il1b)    04936 Alcoholic liver disease     121460531 (Il1b)    04932 Non-alcoholic fatty liver disease     121460531 (Il1b)    04933 AGE-RAGE signaling pathway in diabetic complications     121460531 (Il1b)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     121460531 (Il1b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121460531 (Il1b)    00536 Glycosaminoglycan binding proteins [BR:morg00536]     121460531 (Il1b) Cytokines and neuropeptides [BR:morg04052]  Cytokines   Interleukins    121460531 (Il1b) Glycosaminoglycan binding proteins [BR:morg00536]  Heparan sulfate / Heparin   Cytokines    121460531 (Il1b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep ZinT Motif Other DBs NCBI-GeneID:  121460531 NCBI-ProteinID:  XP_041526922 LinkDB All DBs Position Unknown AA seq 267 aa AA seqDB search MATVPELNSEMAAFQSDENDLFFEVDEPQKMKSCFQAVDLSFPDESIQLQISQQHFNKSF RQVASLIVAVEKLWNIPAPCSWTFQDEDLRTFFSSIFEEEPLLCEYWDGELLVADVPIRQ LHCRLRDEQQKCLVLSDPCELKALHLNGQNINQQVIFSMSYVQGETSNNKIPVALGVKGK NLYLSCVLKGGMPTLQLESLDPKQYPKKKMEKRFVFNKIEIKSKVEFESAQFPNWYISTS QAEHKPVFLGNNSGQDIIDFTMESISS NT seq 804 nt NT seq  +upstreamnt  +downstreamnt atggcaactgttcctgaactcaacagtgaaatggcagctttccagagtgatgagaatgac ctgttctttgaggttgacgaaccccaaaagatgaagagctgcttccaagctgttgacctg agctttccagacgagagcatccagctccaaatctcccagcagcatttcaacaagagcttc aggcaggtggcgtcacttatcgtggctgtggagaagctgtggaacattcctgccccttgc tcgtggaccttccaggatgaggacttgagaaccttcttttcctccatctttgaagaagag cccctcctctgtgagtactgggacggcgagctgcttgtggctgatgttcccattcgtcag ctgcactgcaggctccgagatgaacaacagaaatgccttgtgctgtctgacccctgtgaa ctgaaagctctccacctcaatgggcagaatataaaccaacaagtgatcttctccatgagc tacgtgcagggggaaacaagcaacaacaagatacctgtggccttgggagtcaaggggaag aatctgtacctgtcctgtgtgctgaaaggtggcatgcccaccctgcagctggagagttta gatcccaaacaatacccaaagaagaagatggaaaagcggtttgtcttcaacaagatagaa atcaaatccaaggtggagtttgagtctgcgcagttccccaactggtacatcagcacctcc caagcagaacataagcctgtcttcctgggaaacaacagcggccaggatataattgacttc accatggaatccatatcttcctag

DBGET integrated database retrieval system