Microtus oregoni (creeping vole): 121460561 Help Entry 121460561         CDS       T08307                                  Symbol Mtln Name (RefSeq) mitoregulin   KO K29035   mitoregulin Organism morg  Microtus oregoni (creeping vole) Brite KEGG Orthology (KO) [BR:morg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:morg03029]     121460561 (Mtln) Mitochondrial biogenesis [BR:morg03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     121460561 (Mtln) SSDB OrthologParalogGFIT Motif Pfam:  MTLN LapA_dom CheW_CheR_link Motif Other DBs NCBI-GeneID:  121460561 NCBI-ProteinID:  XP_041526966 LinkDB All DBs Position Unknown AA seq 56 aa AA seqDB search MADVSDRTLQVSVLVAFASGVVLGWQANRLRRRYLDWRKRRLQDKLATTQKKLDLA NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atggcggacgtgtcagataggacgctgcaggtgtccgtgctagtggctttcgcctctgga gtggtcctcggctggcaagcgaatcggctgcggaggcgttacctggactggaggaagcgg aggttgcaagacaagctggcgacaactcagaagaagctggacctggcctga

DBGET integrated database retrieval system